Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N4P3

Protein Details
Accession A0A1C7N4P3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-107LAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKEBasic
NLS Segment(s)
PositionSequence
65-107PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
Subcellular Location(s) cyto 13, cyto_nucl 11, nucl 7, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDVIHPGLPNVSKDELRTKIGKMYKAEKDVVSVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.29
4 0.3
5 0.33
6 0.34
7 0.31
8 0.36
9 0.4
10 0.42
11 0.4
12 0.44
13 0.46
14 0.48
15 0.49
16 0.41
17 0.4
18 0.35
19 0.33
20 0.26
21 0.2
22 0.16
23 0.16
24 0.17
25 0.14
26 0.14
27 0.12
28 0.13
29 0.12
30 0.14
31 0.13
32 0.14
33 0.14
34 0.12
35 0.12
36 0.1
37 0.09
38 0.09
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.12
49 0.14
50 0.21
51 0.28
52 0.33
53 0.43
54 0.46
55 0.49
56 0.46
57 0.5
58 0.46
59 0.42
60 0.39
61 0.31
62 0.26
63 0.21
64 0.22
65 0.19
66 0.2
67 0.25
68 0.31
69 0.38
70 0.49
71 0.59
72 0.69
73 0.77
74 0.85
75 0.89
76 0.92
77 0.94
78 0.94
79 0.93
80 0.93
81 0.93
82 0.92
83 0.92
84 0.92
85 0.92
86 0.92
87 0.94