Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MY48

Protein Details
Accession A0A1C7MY48    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
112-136EEKPKEEKKEEKPKEEKKEEKPKEEAcidic
160-183YLRQREFMKKQQKKEASQKLKTLQHydrophilic
NLS Segment(s)
PositionSequence
102-144RKSSEEEKKEEEKPKEEKKEEKPKEEKKEEKPKEEEKEEKRNP
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFTPTLQNLYVARLTTQERPCFVCSKFTNVVLTSADNSNSDWFYTCKTHLGDTNFCSKLGGPKPVAKQDHKKDIALDNRKPESDSVADLVSSIGSAWKSWRKSSEEEKKEEEKPKEEKKEEKPKEEKKEEKPKEEEKEEKRNPPSPXQPVRFVIQRDYFYLRQREFMKKQQKKEASQKLKTLQFPKVPKSLPTLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.29
4 0.36
5 0.36
6 0.37
7 0.4
8 0.43
9 0.44
10 0.42
11 0.42
12 0.37
13 0.4
14 0.42
15 0.39
16 0.4
17 0.36
18 0.37
19 0.28
20 0.28
21 0.22
22 0.2
23 0.19
24 0.16
25 0.16
26 0.16
27 0.15
28 0.14
29 0.13
30 0.12
31 0.15
32 0.18
33 0.18
34 0.2
35 0.21
36 0.22
37 0.26
38 0.31
39 0.32
40 0.31
41 0.38
42 0.34
43 0.33
44 0.31
45 0.27
46 0.3
47 0.29
48 0.32
49 0.27
50 0.32
51 0.37
52 0.45
53 0.5
54 0.48
55 0.54
56 0.55
57 0.63
58 0.59
59 0.55
60 0.5
61 0.52
62 0.55
63 0.53
64 0.5
65 0.46
66 0.46
67 0.45
68 0.43
69 0.36
70 0.3
71 0.23
72 0.2
73 0.14
74 0.12
75 0.12
76 0.11
77 0.1
78 0.07
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.07
85 0.12
86 0.14
87 0.16
88 0.2
89 0.23
90 0.28
91 0.38
92 0.46
93 0.47
94 0.49
95 0.53
96 0.53
97 0.56
98 0.6
99 0.53
100 0.48
101 0.51
102 0.56
103 0.59
104 0.59
105 0.61
106 0.64
107 0.72
108 0.72
109 0.73
110 0.74
111 0.75
112 0.8
113 0.82
114 0.8
115 0.79
116 0.84
117 0.8
118 0.78
119 0.76
120 0.74
121 0.72
122 0.71
123 0.7
124 0.66
125 0.71
126 0.7
127 0.71
128 0.69
129 0.68
130 0.65
131 0.65
132 0.68
133 0.66
134 0.65
135 0.61
136 0.59
137 0.56
138 0.56
139 0.51
140 0.47
141 0.44
142 0.39
143 0.38
144 0.41
145 0.41
146 0.44
147 0.48
148 0.42
149 0.42
150 0.46
151 0.52
152 0.52
153 0.58
154 0.63
155 0.63
156 0.71
157 0.75
158 0.79
159 0.78
160 0.83
161 0.84
162 0.83
163 0.82
164 0.82
165 0.79
166 0.78
167 0.77
168 0.72
169 0.69
170 0.67
171 0.68
172 0.66
173 0.66
174 0.61
175 0.55
176 0.57