Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N6J7

Protein Details
Accession A0A1C7N6J7    Localization Confidence High Confidence Score 22.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-37ASSPPPTKKTTVKQEDTNKKRRVLPTKKAEDAPHydrophilic
671-693QLPTKIKSTLTRRYNNSKHPVLFHydrophilic
NLS Segment(s)
PositionSequence
22-36NKKRRVLPTKKAEDA
48-53EKPKPA
162-184KKPSTAPPPKAAAPKIAKGKGKA
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
IPR008921  DNA_pol3_clamp-load_cplx_C  
IPR013725  DNA_replication_fac_RFC1_C  
IPR027417  P-loop_NTPase  
IPR012178  RFC1  
Gene Ontology GO:0005663  C:DNA replication factor C complex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0003689  F:DNA clamp loader activity  
GO:0006281  P:DNA repair  
GO:0006271  P:DNA strand elongation involved in DNA replication  
Pfam View protein in Pfam  
PF00004  AAA  
PF00533  BRCT  
PF08519  RFC1  
PROSITE View protein in PROSITE  
PS50172  BRCT  
CDD cd00009  AAA  
cd18140  HLD_clamp_RFC  
Amino Acid Sequences KAKKASSPPPTKKTTVKQEDTNKKRRVLPTKKAEDAPIKQEEGKQEEEKPKPAAKKNYFAMMKSVEGPKALGTRPEPVGAPNCLDGLAFVISGQYETLTKEQTKDIVMRYGGRVTGAVSGKTHYLLRGRDAGESKLAKAKSVGTKILNEDEFYELVENPAEKKPSTAPPPKAAAPKIAKGKGKAAETKTDTSNSVDTKSLLWTEKYKPTELKEIIGNKELVNTISQWLAQWQESLANGFEGSDIHSHRAVLLSGPPGIGKTTTANVVARVNGYEALEFNASDVRSKKILEESISEMMDNRTMTEFFQASKNQANRMIKGKKVVLIMDEVDGMSEGDRGGAAELARMIKESKIPVICICNDSRSQKVAPLLRVCYEAKFRRSTAAQIRSRILSIAYKENLNITPNAIDELVAATQNDIRQIINILSAYRINETSLSYDQAKTLGKSNQKNSTVGLFDIPGELLTGGSWRSKSLTEKYEIYFNDYSLSNLMIQMYTYFLKQENYLKCLPELARSETGNPKETACNEMDLFAKASEAIADGDLADAMIHGTTQHWSLMPVHSIFSCVRPASFVRGGVQSRYNFPGWLGQNSKADKYSRQLSEVQARMRLKASGDKYEIRQNYIPTLNDRIIKELQDGDYDGAMEIMDSYYLDRECLDTFNDLTFAPTGKGPLAQLPTKIKSTLTRRYNNSKHPVLFQSIKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.75
4 0.76
5 0.8
6 0.85
7 0.87
8 0.87
9 0.83
10 0.79
11 0.8
12 0.8
13 0.81
14 0.8
15 0.8
16 0.81
17 0.83
18 0.84
19 0.78
20 0.76
21 0.74
22 0.69
23 0.66
24 0.61
25 0.55
26 0.5
27 0.51
28 0.51
29 0.46
30 0.47
31 0.43
32 0.46
33 0.52
34 0.55
35 0.56
36 0.55
37 0.58
38 0.6
39 0.66
40 0.68
41 0.66
42 0.7
43 0.68
44 0.72
45 0.68
46 0.6
47 0.57
48 0.49
49 0.43
50 0.39
51 0.39
52 0.31
53 0.28
54 0.27
55 0.25
56 0.26
57 0.25
58 0.26
59 0.24
60 0.28
61 0.3
62 0.31
63 0.28
64 0.28
65 0.31
66 0.28
67 0.28
68 0.23
69 0.22
70 0.2
71 0.19
72 0.15
73 0.12
74 0.1
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.09
84 0.11
85 0.15
86 0.17
87 0.19
88 0.21
89 0.22
90 0.25
91 0.26
92 0.27
93 0.28
94 0.28
95 0.29
96 0.29
97 0.29
98 0.26
99 0.23
100 0.2
101 0.16
102 0.21
103 0.2
104 0.18
105 0.17
106 0.18
107 0.18
108 0.2
109 0.19
110 0.16
111 0.2
112 0.2
113 0.24
114 0.29
115 0.29
116 0.33
117 0.34
118 0.33
119 0.34
120 0.34
121 0.32
122 0.32
123 0.31
124 0.26
125 0.25
126 0.3
127 0.31
128 0.34
129 0.38
130 0.34
131 0.37
132 0.4
133 0.44
134 0.38
135 0.31
136 0.28
137 0.25
138 0.22
139 0.19
140 0.17
141 0.11
142 0.11
143 0.12
144 0.11
145 0.11
146 0.15
147 0.17
148 0.15
149 0.18
150 0.22
151 0.29
152 0.38
153 0.44
154 0.46
155 0.49
156 0.54
157 0.57
158 0.59
159 0.52
160 0.52
161 0.47
162 0.49
163 0.51
164 0.53
165 0.52
166 0.48
167 0.53
168 0.49
169 0.5
170 0.51
171 0.45
172 0.47
173 0.48
174 0.49
175 0.44
176 0.41
177 0.37
178 0.32
179 0.33
180 0.26
181 0.23
182 0.21
183 0.19
184 0.18
185 0.18
186 0.19
187 0.17
188 0.18
189 0.2
190 0.25
191 0.32
192 0.34
193 0.36
194 0.37
195 0.38
196 0.46
197 0.42
198 0.39
199 0.37
200 0.39
201 0.38
202 0.38
203 0.35
204 0.25
205 0.26
206 0.24
207 0.19
208 0.15
209 0.13
210 0.11
211 0.1
212 0.1
213 0.08
214 0.09
215 0.1
216 0.1
217 0.09
218 0.09
219 0.09
220 0.1
221 0.11
222 0.1
223 0.08
224 0.07
225 0.07
226 0.07
227 0.06
228 0.07
229 0.08
230 0.09
231 0.11
232 0.12
233 0.11
234 0.11
235 0.12
236 0.11
237 0.09
238 0.1
239 0.1
240 0.1
241 0.1
242 0.1
243 0.09
244 0.09
245 0.09
246 0.07
247 0.08
248 0.08
249 0.1
250 0.11
251 0.11
252 0.12
253 0.13
254 0.13
255 0.12
256 0.11
257 0.1
258 0.1
259 0.09
260 0.08
261 0.07
262 0.08
263 0.08
264 0.08
265 0.07
266 0.09
267 0.09
268 0.11
269 0.12
270 0.13
271 0.14
272 0.14
273 0.16
274 0.17
275 0.2
276 0.19
277 0.2
278 0.22
279 0.23
280 0.23
281 0.21
282 0.17
283 0.15
284 0.16
285 0.13
286 0.1
287 0.08
288 0.08
289 0.09
290 0.11
291 0.11
292 0.1
293 0.13
294 0.14
295 0.15
296 0.21
297 0.22
298 0.22
299 0.28
300 0.29
301 0.28
302 0.36
303 0.38
304 0.33
305 0.36
306 0.35
307 0.32
308 0.31
309 0.29
310 0.21
311 0.19
312 0.18
313 0.14
314 0.12
315 0.09
316 0.07
317 0.07
318 0.06
319 0.04
320 0.04
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.04
327 0.04
328 0.04
329 0.05
330 0.05
331 0.05
332 0.06
333 0.06
334 0.06
335 0.08
336 0.09
337 0.12
338 0.12
339 0.13
340 0.13
341 0.16
342 0.16
343 0.17
344 0.16
345 0.15
346 0.18
347 0.19
348 0.2
349 0.2
350 0.19
351 0.2
352 0.24
353 0.25
354 0.26
355 0.27
356 0.27
357 0.25
358 0.28
359 0.26
360 0.23
361 0.27
362 0.27
363 0.28
364 0.3
365 0.29
366 0.29
367 0.3
368 0.34
369 0.36
370 0.42
371 0.41
372 0.41
373 0.43
374 0.4
375 0.39
376 0.32
377 0.24
378 0.17
379 0.16
380 0.18
381 0.17
382 0.17
383 0.17
384 0.18
385 0.18
386 0.17
387 0.15
388 0.11
389 0.1
390 0.1
391 0.11
392 0.09
393 0.08
394 0.06
395 0.07
396 0.06
397 0.06
398 0.06
399 0.05
400 0.06
401 0.07
402 0.08
403 0.07
404 0.07
405 0.07
406 0.08
407 0.08
408 0.08
409 0.08
410 0.08
411 0.08
412 0.09
413 0.09
414 0.1
415 0.1
416 0.09
417 0.09
418 0.1
419 0.12
420 0.12
421 0.14
422 0.14
423 0.15
424 0.14
425 0.16
426 0.17
427 0.14
428 0.18
429 0.22
430 0.28
431 0.34
432 0.4
433 0.46
434 0.47
435 0.47
436 0.43
437 0.41
438 0.34
439 0.28
440 0.23
441 0.14
442 0.12
443 0.12
444 0.1
445 0.07
446 0.06
447 0.05
448 0.04
449 0.04
450 0.05
451 0.05
452 0.07
453 0.07
454 0.07
455 0.09
456 0.11
457 0.16
458 0.22
459 0.26
460 0.28
461 0.31
462 0.32
463 0.36
464 0.34
465 0.36
466 0.3
467 0.26
468 0.24
469 0.21
470 0.21
471 0.15
472 0.16
473 0.09
474 0.09
475 0.09
476 0.07
477 0.07
478 0.07
479 0.08
480 0.08
481 0.08
482 0.09
483 0.09
484 0.11
485 0.13
486 0.21
487 0.22
488 0.27
489 0.29
490 0.29
491 0.28
492 0.32
493 0.3
494 0.29
495 0.29
496 0.29
497 0.31
498 0.3
499 0.35
500 0.37
501 0.4
502 0.37
503 0.34
504 0.31
505 0.3
506 0.31
507 0.31
508 0.24
509 0.24
510 0.2
511 0.21
512 0.2
513 0.18
514 0.18
515 0.13
516 0.13
517 0.09
518 0.09
519 0.08
520 0.08
521 0.07
522 0.06
523 0.06
524 0.05
525 0.05
526 0.05
527 0.05
528 0.04
529 0.03
530 0.03
531 0.03
532 0.03
533 0.03
534 0.04
535 0.05
536 0.06
537 0.07
538 0.07
539 0.09
540 0.11
541 0.14
542 0.16
543 0.16
544 0.16
545 0.15
546 0.18
547 0.17
548 0.17
549 0.19
550 0.16
551 0.16
552 0.18
553 0.19
554 0.24
555 0.26
556 0.25
557 0.24
558 0.29
559 0.31
560 0.31
561 0.36
562 0.31
563 0.32
564 0.35
565 0.33
566 0.27
567 0.26
568 0.31
569 0.27
570 0.33
571 0.32
572 0.33
573 0.39
574 0.41
575 0.43
576 0.39
577 0.39
578 0.36
579 0.38
580 0.43
581 0.38
582 0.39
583 0.41
584 0.43
585 0.5
586 0.51
587 0.48
588 0.47
589 0.45
590 0.44
591 0.42
592 0.38
593 0.31
594 0.34
595 0.35
596 0.35
597 0.39
598 0.41
599 0.43
600 0.51
601 0.5
602 0.48
603 0.47
604 0.41
605 0.43
606 0.43
607 0.42
608 0.37
609 0.41
610 0.38
611 0.4
612 0.39
613 0.37
614 0.35
615 0.34
616 0.33
617 0.31
618 0.28
619 0.25
620 0.26
621 0.22
622 0.19
623 0.18
624 0.15
625 0.11
626 0.1
627 0.07
628 0.06
629 0.05
630 0.05
631 0.05
632 0.06
633 0.09
634 0.09
635 0.1
636 0.1
637 0.11
638 0.13
639 0.14
640 0.15
641 0.15
642 0.16
643 0.17
644 0.17
645 0.15
646 0.16
647 0.16
648 0.15
649 0.13
650 0.13
651 0.14
652 0.14
653 0.16
654 0.15
655 0.2
656 0.25
657 0.26
658 0.32
659 0.38
660 0.41
661 0.42
662 0.42
663 0.39
664 0.42
665 0.48
666 0.52
667 0.55
668 0.59
669 0.65
670 0.74
671 0.81
672 0.82
673 0.82
674 0.81
675 0.74
676 0.72
677 0.69
678 0.66
679 0.63