Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7NM08

Protein Details
Accession A0A1C7NM08    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-35GLNAARKLRIHRRDQRWADKQYKKRALGHydrophilic
NLS Segment(s)
PositionSequence
13-22RKLRIHRRDQ
Subcellular Location(s) mito 13, cyto 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005680  Ribosomal_S23_euk/arc  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03367  Ribosomal_S23  
Amino Acid Sequences MGKGQPRGLNAARKLRIHRRDQRWADKQYKKRALGTAFRSSPFGGSSHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLIAGFGRKGRAIGDIPGVRFKIVKVAGVSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.69
4 0.71
5 0.75
6 0.74
7 0.79
8 0.84
9 0.86
10 0.85
11 0.84
12 0.84
13 0.84
14 0.83
15 0.84
16 0.83
17 0.76
18 0.72
19 0.7
20 0.66
21 0.64
22 0.62
23 0.6
24 0.52
25 0.49
26 0.46
27 0.39
28 0.34
29 0.26
30 0.2
31 0.15
32 0.15
33 0.16
34 0.16
35 0.16
36 0.15
37 0.15
38 0.15
39 0.14
40 0.12
41 0.11
42 0.09
43 0.09
44 0.1
45 0.1
46 0.09
47 0.11
48 0.11
49 0.14
50 0.14
51 0.15
52 0.21
53 0.21
54 0.25
55 0.24
56 0.28
57 0.26
58 0.31
59 0.34
60 0.34
61 0.35
62 0.41
63 0.5
64 0.5
65 0.54
66 0.5
67 0.46
68 0.4
69 0.4
70 0.32
71 0.31
72 0.27
73 0.26
74 0.27
75 0.27
76 0.27
77 0.26
78 0.24
79 0.14
80 0.16
81 0.13
82 0.1
83 0.13
84 0.12
85 0.12
86 0.11
87 0.11
88 0.08
89 0.07
90 0.07
91 0.05
92 0.05
93 0.06
94 0.06
95 0.08
96 0.08
97 0.08
98 0.09
99 0.13
100 0.15
101 0.16
102 0.24
103 0.26
104 0.27
105 0.32
106 0.32
107 0.28
108 0.27
109 0.25
110 0.25
111 0.23
112 0.25
113 0.22