Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NIB5

Protein Details
Accession A0A1C7NIB5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-148AKKTTCRDKKTSHVKKHKTTTAKHKAHBasic
NLS Segment(s)
PositionSequence
92-101KKTTHKKKGI
Subcellular Location(s) nucl 18, mito_nucl 13.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences NSTCKNTTTTNTAPCNHHKTTKPHNTTTTSNSHHKTTAPCNHHSTTRSKPHTKGTSKTCGCQRHSTSAHHHSTKKTCSHHAKKTTTAGHHVKKTTHKKKGITAHHGKKTTCSNKKTTTSHHAKKTTCRDKKTSHVKKHKTTTAKHKAHTPGCSNVCPSGCGTKTVTKVIYVTAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.56
4 0.58
5 0.57
6 0.6
7 0.66
8 0.72
9 0.71
10 0.7
11 0.72
12 0.69
13 0.66
14 0.63
15 0.61
16 0.55
17 0.56
18 0.52
19 0.48
20 0.44
21 0.43
22 0.43
23 0.44
24 0.48
25 0.45
26 0.48
27 0.51
28 0.52
29 0.53
30 0.51
31 0.48
32 0.48
33 0.53
34 0.56
35 0.56
36 0.57
37 0.62
38 0.69
39 0.68
40 0.66
41 0.63
42 0.65
43 0.61
44 0.63
45 0.61
46 0.58
47 0.57
48 0.58
49 0.55
50 0.53
51 0.55
52 0.54
53 0.54
54 0.55
55 0.56
56 0.53
57 0.52
58 0.48
59 0.51
60 0.52
61 0.51
62 0.45
63 0.48
64 0.54
65 0.59
66 0.63
67 0.66
68 0.64
69 0.61
70 0.64
71 0.6
72 0.51
73 0.5
74 0.48
75 0.44
76 0.45
77 0.43
78 0.4
79 0.45
80 0.54
81 0.57
82 0.59
83 0.6
84 0.59
85 0.65
86 0.71
87 0.7
88 0.68
89 0.69
90 0.69
91 0.7
92 0.71
93 0.63
94 0.58
95 0.59
96 0.6
97 0.58
98 0.54
99 0.54
100 0.57
101 0.65
102 0.65
103 0.61
104 0.61
105 0.63
106 0.66
107 0.68
108 0.68
109 0.63
110 0.69
111 0.73
112 0.74
113 0.72
114 0.71
115 0.69
116 0.68
117 0.75
118 0.77
119 0.77
120 0.77
121 0.79
122 0.82
123 0.85
124 0.88
125 0.87
126 0.83
127 0.81
128 0.81
129 0.81
130 0.79
131 0.72
132 0.71
133 0.72
134 0.7
135 0.69
136 0.63
137 0.61
138 0.59
139 0.59
140 0.53
141 0.49
142 0.43
143 0.37
144 0.34
145 0.33
146 0.29
147 0.3
148 0.32
149 0.34
150 0.36
151 0.4
152 0.39
153 0.32
154 0.32