Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N890

Protein Details
Accession A0A1C7N890    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
117-136SVDCRSRRYALCRRKPKRSNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 1, plas 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016186  C-type_lectin-like/link_sf  
IPR016187  CTDL_fold  
Amino Acid Sequences MFKLTYAASLIAGLAALVAAQDSIEGGFVCDYPGTDGYYFSKKLSYWESANESCGPEGTLASVTNRNFFIATDMIRNCIGEDGASWIGTWDYTSADPQVRQCLTLYVDYEANGGGISVDCRSRRYALCRRKPKRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.08
20 0.09
21 0.1
22 0.1
23 0.12
24 0.14
25 0.18
26 0.19
27 0.17
28 0.18
29 0.16
30 0.19
31 0.23
32 0.23
33 0.21
34 0.24
35 0.29
36 0.28
37 0.3
38 0.28
39 0.24
40 0.2
41 0.19
42 0.15
43 0.09
44 0.09
45 0.07
46 0.06
47 0.06
48 0.08
49 0.12
50 0.11
51 0.13
52 0.13
53 0.13
54 0.12
55 0.12
56 0.12
57 0.09
58 0.1
59 0.12
60 0.12
61 0.14
62 0.13
63 0.13
64 0.11
65 0.1
66 0.1
67 0.06
68 0.06
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.04
78 0.05
79 0.06
80 0.07
81 0.09
82 0.11
83 0.13
84 0.15
85 0.21
86 0.2
87 0.2
88 0.2
89 0.2
90 0.2
91 0.21
92 0.21
93 0.17
94 0.17
95 0.16
96 0.16
97 0.13
98 0.11
99 0.08
100 0.07
101 0.05
102 0.05
103 0.05
104 0.07
105 0.11
106 0.12
107 0.15
108 0.18
109 0.23
110 0.28
111 0.37
112 0.46
113 0.53
114 0.63
115 0.72
116 0.78