Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MXS5

Protein Details
Accession A0A1C7MXS5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAVGKNKRLSKGKKGLKKKVVDPFTHydrophilic
NLS Segment(s)
PositionSequence
5-19KNKRLSKGKKGLKKK
Subcellular Location(s) nucl 14, mito 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MAVGKNKRLSKGKKGLKKKVVDPFTRKDWYDIKAPSMFDVRQVGKTLVNRTQGLRNANDSLHGRVVEMSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.85
4 0.84
5 0.81
6 0.8
7 0.79
8 0.77
9 0.73
10 0.68
11 0.66
12 0.64
13 0.56
14 0.5
15 0.44
16 0.38
17 0.38
18 0.34
19 0.3
20 0.28
21 0.27
22 0.25
23 0.24
24 0.21
25 0.17
26 0.2
27 0.18
28 0.17
29 0.19
30 0.19
31 0.19
32 0.23
33 0.26
34 0.26
35 0.3
36 0.3
37 0.3
38 0.36
39 0.37
40 0.38
41 0.36
42 0.35
43 0.32
44 0.31
45 0.34
46 0.3
47 0.29
48 0.28
49 0.26
50 0.22
51 0.2