Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NKB3

Protein Details
Accession A0A1C7NKB3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-41PSYNLRHPPREIKPFKRQKRGKDVKVVLPHydrophilic
120-139ITIIRRPKRRPVRQEVASNVHydrophilic
NLS Segment(s)
PositionSequence
21-34PREIKPFKRQKRGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MNSELQLNDTPAPSYNLRHPPREIKPFKRQKRGKDVKVVLPTPMEWDSCPPAPAEEEKPVPMEIVGNQQEEEEEACPDVTDMTLDQETEYVMKEAVDVAKTRPGKKIVLVHSDSEDEIEITIIRRPKRRPVRQEVASNVYRTSPSIKSAMICFKKKEEVCKQPSGYLLERQLLLVKNSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.37
4 0.41
5 0.45
6 0.49
7 0.54
8 0.61
9 0.69
10 0.7
11 0.68
12 0.75
13 0.81
14 0.85
15 0.87
16 0.86
17 0.85
18 0.87
19 0.89
20 0.86
21 0.86
22 0.82
23 0.79
24 0.8
25 0.7
26 0.6
27 0.51
28 0.43
29 0.36
30 0.32
31 0.24
32 0.16
33 0.18
34 0.21
35 0.2
36 0.21
37 0.16
38 0.15
39 0.17
40 0.2
41 0.2
42 0.2
43 0.2
44 0.21
45 0.22
46 0.21
47 0.19
48 0.16
49 0.13
50 0.1
51 0.15
52 0.17
53 0.16
54 0.16
55 0.15
56 0.15
57 0.15
58 0.15
59 0.08
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.14
87 0.16
88 0.18
89 0.22
90 0.24
91 0.24
92 0.27
93 0.34
94 0.32
95 0.37
96 0.38
97 0.35
98 0.34
99 0.33
100 0.29
101 0.22
102 0.17
103 0.1
104 0.08
105 0.07
106 0.06
107 0.05
108 0.09
109 0.13
110 0.17
111 0.23
112 0.27
113 0.38
114 0.49
115 0.58
116 0.66
117 0.71
118 0.77
119 0.78
120 0.82
121 0.77
122 0.73
123 0.65
124 0.56
125 0.46
126 0.38
127 0.31
128 0.25
129 0.24
130 0.19
131 0.18
132 0.2
133 0.2
134 0.2
135 0.25
136 0.34
137 0.36
138 0.39
139 0.4
140 0.42
141 0.5
142 0.51
143 0.57
144 0.57
145 0.6
146 0.63
147 0.69
148 0.67
149 0.61
150 0.62
151 0.58
152 0.51
153 0.47
154 0.44
155 0.38
156 0.36
157 0.34
158 0.35
159 0.31