Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N0E4

Protein Details
Accession A0A1C7N0E4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-31ADSHIKKESSKAKPDKRSRSKTPNNVDEQIHydrophilic
NLS Segment(s)
PositionSequence
10-20SSKAKPDKRSR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MADSHIKKESSKAKPDKRSRSKTPNNVDEQILRDVLAKSAKARDAQNEGVLLFQKMSCISIESEKRKTSWLDKIEVPLPSILMPDYARIMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.88
4 0.89
5 0.89
6 0.88
7 0.89
8 0.9
9 0.89
10 0.88
11 0.86
12 0.81
13 0.74
14 0.66
15 0.57
16 0.5
17 0.41
18 0.32
19 0.23
20 0.18
21 0.16
22 0.16
23 0.15
24 0.12
25 0.12
26 0.14
27 0.16
28 0.17
29 0.18
30 0.19
31 0.23
32 0.23
33 0.23
34 0.2
35 0.18
36 0.16
37 0.15
38 0.12
39 0.08
40 0.06
41 0.06
42 0.06
43 0.07
44 0.06
45 0.07
46 0.08
47 0.15
48 0.22
49 0.27
50 0.32
51 0.33
52 0.34
53 0.35
54 0.38
55 0.38
56 0.4
57 0.38
58 0.38
59 0.39
60 0.42
61 0.44
62 0.41
63 0.36
64 0.27
65 0.23
66 0.19
67 0.18
68 0.13
69 0.12
70 0.11
71 0.12