Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NBE7

Protein Details
Accession A0A1C7NBE7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-48VFDKDRSKKKSTKSKRTYQKSNVVEHydrophilic
NLS Segment(s)
PositionSequence
31-37KKKSTKS
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MQVGAETSKSLQAFLVLKWYMRLVFDKDRSKKKSTKSKRTYQKSNVVEEFEALKENLAENAVSAATTLIYAIGTEIVAAAGIRPALRLILVKGFKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.22
3 0.18
4 0.18
5 0.19
6 0.2
7 0.17
8 0.17
9 0.2
10 0.18
11 0.26
12 0.34
13 0.42
14 0.49
15 0.58
16 0.62
17 0.66
18 0.66
19 0.68
20 0.72
21 0.73
22 0.77
23 0.76
24 0.8
25 0.84
26 0.87
27 0.87
28 0.84
29 0.82
30 0.75
31 0.72
32 0.64
33 0.55
34 0.46
35 0.36
36 0.29
37 0.2
38 0.16
39 0.1
40 0.09
41 0.07
42 0.07
43 0.07
44 0.06
45 0.05
46 0.04
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.09
75 0.11
76 0.19