Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NSP9

Protein Details
Accession A0A1C7NSP9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-121LTSVLRKRRLKMNKHKHKKLRKRTRALRKKLGKBasic
NLS Segment(s)
PositionSequence
94-121RKRRLKMNKHKHKKLRKRTRALRKKLGK
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLFCRLLTTAVRPSARLAQRYVSTSTRIDTAMNPVLEFKKSLLNSTSSTQPASVASVSEYVSRLRPFNVPAAPQPTMTTPTKTAETLELTSVLRKRRLKMNKHKHKKLRKRTRALRKKLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.41
4 0.37
5 0.35
6 0.38
7 0.4
8 0.41
9 0.34
10 0.32
11 0.3
12 0.29
13 0.25
14 0.22
15 0.2
16 0.16
17 0.2
18 0.22
19 0.21
20 0.2
21 0.21
22 0.21
23 0.21
24 0.21
25 0.15
26 0.17
27 0.17
28 0.19
29 0.19
30 0.2
31 0.22
32 0.23
33 0.26
34 0.2
35 0.2
36 0.18
37 0.17
38 0.14
39 0.13
40 0.11
41 0.07
42 0.07
43 0.08
44 0.08
45 0.08
46 0.09
47 0.08
48 0.1
49 0.11
50 0.11
51 0.12
52 0.13
53 0.13
54 0.17
55 0.18
56 0.18
57 0.2
58 0.25
59 0.24
60 0.23
61 0.22
62 0.19
63 0.22
64 0.22
65 0.21
66 0.18
67 0.2
68 0.21
69 0.2
70 0.2
71 0.18
72 0.2
73 0.18
74 0.17
75 0.16
76 0.15
77 0.19
78 0.22
79 0.24
80 0.29
81 0.32
82 0.35
83 0.44
84 0.53
85 0.6
86 0.68
87 0.75
88 0.78
89 0.86
90 0.93
91 0.93
92 0.95
93 0.95
94 0.95
95 0.95
96 0.95
97 0.95
98 0.95
99 0.96
100 0.96
101 0.95