Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N316

Protein Details
Accession A0A1C7N316    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-108LLDEKKQKQKTTKPVNRQYHRKQNRDAIKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSTIVRSSRPIYQPTLVRASYLHTTLLARNTADATTTTTRKPSAAPKGTVLKGLQYIKDKPEPVALDDSEYPDWLWDLLDEKKQKQKTTKPVNRQYHRKQNRDAIKAMNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.48
4 0.4
5 0.36
6 0.32
7 0.31
8 0.28
9 0.25
10 0.2
11 0.15
12 0.16
13 0.18
14 0.21
15 0.18
16 0.15
17 0.15
18 0.15
19 0.14
20 0.14
21 0.12
22 0.14
23 0.16
24 0.18
25 0.18
26 0.19
27 0.2
28 0.2
29 0.22
30 0.25
31 0.31
32 0.35
33 0.36
34 0.38
35 0.43
36 0.43
37 0.43
38 0.35
39 0.26
40 0.25
41 0.24
42 0.23
43 0.21
44 0.22
45 0.23
46 0.26
47 0.26
48 0.22
49 0.25
50 0.23
51 0.21
52 0.23
53 0.2
54 0.18
55 0.18
56 0.2
57 0.16
58 0.15
59 0.13
60 0.1
61 0.1
62 0.07
63 0.07
64 0.05
65 0.07
66 0.1
67 0.16
68 0.2
69 0.23
70 0.32
71 0.37
72 0.42
73 0.49
74 0.56
75 0.61
76 0.69
77 0.75
78 0.78
79 0.84
80 0.89
81 0.89
82 0.9
83 0.9
84 0.9
85 0.9
86 0.87
87 0.84
88 0.84
89 0.84
90 0.79
91 0.72
92 0.69
93 0.63
94 0.62
95 0.56
96 0.54
97 0.47