Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MUV9

Protein Details
Accession A0A1C7MUV9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-29NISPPKASSEKSKKRPRVSSVLVHydrophilic
45-70VLDNTIKKPKKTRGRPKKATEEPSSEHydrophilic
NLS Segment(s)
PositionSequence
12-23KASSEKSKKRPR
37-62RKRGRPKKVLDNTIKKPKKTRGRPKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MLSQKRNISPPKASSEKSKKRPRVSSVLVIQPDQDVRKRGRPKKVLDNTIKKPKKTRGRPKKATEEPSSETPVHQFIFQPPDTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.67
4 0.7
5 0.76
6 0.77
7 0.8
8 0.87
9 0.83
10 0.81
11 0.76
12 0.74
13 0.68
14 0.65
15 0.57
16 0.48
17 0.41
18 0.33
19 0.29
20 0.22
21 0.2
22 0.17
23 0.19
24 0.28
25 0.38
26 0.44
27 0.52
28 0.57
29 0.6
30 0.68
31 0.73
32 0.73
33 0.73
34 0.75
35 0.73
36 0.77
37 0.76
38 0.68
39 0.67
40 0.67
41 0.69
42 0.71
43 0.74
44 0.75
45 0.81
46 0.88
47 0.9
48 0.91
49 0.9
50 0.87
51 0.81
52 0.77
53 0.71
54 0.65
55 0.61
56 0.51
57 0.42
58 0.36
59 0.33
60 0.27
61 0.23
62 0.2
63 0.2
64 0.28