Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N4N1

Protein Details
Accession A0A1C7N4N1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-51IRLKINTLPKSKKDKKQHRKSNRIRKHRKSTDQANSRKTBasic
NLS Segment(s)
PositionSequence
21-41PKSKKDKKQHRKSNRIRKHRK
Subcellular Location(s) nucl 17, mito_nucl 13.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MYSVKQEKPSLTIRLKINTLPKSKKDKKQHRKSNRIRKHRKSTDQANSRKTVYWTSERIEPTKFILRTVMIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.45
4 0.48
5 0.47
6 0.52
7 0.52
8 0.55
9 0.62
10 0.69
11 0.74
12 0.77
13 0.8
14 0.83
15 0.88
16 0.91
17 0.91
18 0.94
19 0.95
20 0.95
21 0.94
22 0.94
23 0.93
24 0.92
25 0.92
26 0.91
27 0.89
28 0.85
29 0.85
30 0.84
31 0.83
32 0.81
33 0.75
34 0.68
35 0.61
36 0.55
37 0.47
38 0.41
39 0.37
40 0.35
41 0.33
42 0.33
43 0.38
44 0.39
45 0.39
46 0.37
47 0.33
48 0.32
49 0.38
50 0.35
51 0.3
52 0.3