Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MTS2

Protein Details
Accession A0A1C7MTS2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-176ISERIRRAKTKPTRRQIEYPDVCHydrophilic
NLS Segment(s)
PositionSequence
184-190KTKRRKN
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences ASASASASASASASASASASASASASASASASTAGNSGRKIDLIVKDSQGVELAFCEFEADYKKTSSDHQQSKTLRLNMTILQEMRELFVDEQHVSFVWTGSFGSFVSLQEFQGVSIARFAEPFILPTDIVELDEDVCNTFITLLNWKSHLLSISERIRRAKTKPTRRQIEYPDVCFTVCHQKKTKRRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.09
22 0.11
23 0.11
24 0.13
25 0.13
26 0.13
27 0.14
28 0.18
29 0.21
30 0.23
31 0.25
32 0.23
33 0.25
34 0.25
35 0.24
36 0.19
37 0.15
38 0.11
39 0.09
40 0.09
41 0.07
42 0.06
43 0.07
44 0.05
45 0.07
46 0.11
47 0.12
48 0.13
49 0.14
50 0.14
51 0.15
52 0.17
53 0.26
54 0.3
55 0.37
56 0.39
57 0.47
58 0.48
59 0.54
60 0.58
61 0.52
62 0.43
63 0.36
64 0.35
65 0.29
66 0.3
67 0.26
68 0.19
69 0.16
70 0.16
71 0.15
72 0.14
73 0.11
74 0.1
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.08
81 0.08
82 0.07
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.04
91 0.05
92 0.06
93 0.06
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.1
101 0.1
102 0.08
103 0.08
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.1
115 0.11
116 0.09
117 0.09
118 0.09
119 0.07
120 0.07
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.13
131 0.15
132 0.16
133 0.18
134 0.19
135 0.19
136 0.19
137 0.19
138 0.16
139 0.17
140 0.23
141 0.31
142 0.35
143 0.38
144 0.41
145 0.45
146 0.48
147 0.5
148 0.53
149 0.56
150 0.62
151 0.69
152 0.76
153 0.8
154 0.81
155 0.86
156 0.83
157 0.84
158 0.79
159 0.73
160 0.67
161 0.58
162 0.51
163 0.42
164 0.37
165 0.37
166 0.35
167 0.38
168 0.43
169 0.52
170 0.63