Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MZ72

Protein Details
Accession A0A1C7MZ72    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSSRAPIRKTKAKRRNKHPIQEIVSVHydrophilic
NLS Segment(s)
PositionSequence
6-17PIRKTKAKRRNK
Subcellular Location(s) plas 16, mito 5, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033579  TMEM128  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20479  TMEM128  
Amino Acid Sequences MSSRAPIRKTKAKRRNKHPIQEIVSVLPQLAISFAILYYASTLSDSTFSEHRGFVFYLGCISALTMCSVFLILQIKGVEYKNWQQNPTTRNYIQIASLSTVMAFIAFNVSLWPLYGLLTPFTIIAFFVFAVTVLIISTAFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.92
3 0.92
4 0.92
5 0.9
6 0.89
7 0.84
8 0.79
9 0.7
10 0.61
11 0.52
12 0.41
13 0.32
14 0.22
15 0.15
16 0.1
17 0.09
18 0.06
19 0.05
20 0.05
21 0.04
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.08
33 0.09
34 0.1
35 0.12
36 0.13
37 0.13
38 0.13
39 0.14
40 0.14
41 0.13
42 0.12
43 0.1
44 0.09
45 0.09
46 0.08
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.06
60 0.08
61 0.08
62 0.08
63 0.1
64 0.1
65 0.1
66 0.12
67 0.18
68 0.25
69 0.27
70 0.28
71 0.29
72 0.34
73 0.37
74 0.39
75 0.4
76 0.32
77 0.33
78 0.34
79 0.32
80 0.28
81 0.26
82 0.21
83 0.16
84 0.16
85 0.12
86 0.1
87 0.09
88 0.08
89 0.07
90 0.05
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.07
100 0.06
101 0.07
102 0.08
103 0.09
104 0.09
105 0.1
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.06
118 0.06
119 0.05
120 0.04
121 0.05