Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MYK0

Protein Details
Accession A0A1C7MYK0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-75NQSNKGPRKQRYDWKTNPMTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MDSNYTHKHWTKNRLLVNADEWVDVLKIDESIKLPDNFDFTQLAEQQLQLKDLVNQSNKGPRKQRYDWKTNPMTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.59
4 0.53
5 0.47
6 0.38
7 0.29
8 0.23
9 0.18
10 0.15
11 0.12
12 0.1
13 0.06
14 0.06
15 0.06
16 0.07
17 0.08
18 0.1
19 0.14
20 0.14
21 0.14
22 0.14
23 0.18
24 0.17
25 0.17
26 0.15
27 0.12
28 0.14
29 0.14
30 0.15
31 0.11
32 0.12
33 0.14
34 0.14
35 0.15
36 0.13
37 0.12
38 0.14
39 0.17
40 0.23
41 0.21
42 0.23
43 0.25
44 0.34
45 0.39
46 0.44
47 0.49
48 0.51
49 0.57
50 0.65
51 0.73
52 0.73
53 0.79
54 0.8
55 0.81