Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NQT5

Protein Details
Accession A0A1C7NQT5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
162-185EEYTRNRDLWKKRRRLFNDIFKTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010776  Hop2_WH_dom  
IPR040661  LZ3wCH  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0090304  P:nucleic acid metabolic process  
Pfam View protein in Pfam  
PF18517  LZ3wCH  
PF07106  TBPIP  
Amino Acid Sequences MVKKKTGGTKEEESIVLEYLTKANRPYSATDVFNNLHAKYTKSTIVKILDKLIDDELVFSKTYGKTIIYSIKQNEEESPSEKDMEKMEKSINELNQELEVLLEENKKLEQTMTQLTAKPTTTEAQQLVEKAKLKNEEMRKKLNDLKSGTVLIPSEKRKRINEEYTRNRDLWKKRRRLFNDIFKTVTENYPGNPKELKEQLGVEEDPVPLEKDPLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.22
4 0.16
5 0.14
6 0.15
7 0.16
8 0.16
9 0.16
10 0.18
11 0.21
12 0.23
13 0.26
14 0.29
15 0.32
16 0.33
17 0.33
18 0.35
19 0.33
20 0.35
21 0.34
22 0.28
23 0.28
24 0.26
25 0.27
26 0.25
27 0.27
28 0.29
29 0.28
30 0.3
31 0.3
32 0.36
33 0.37
34 0.36
35 0.37
36 0.32
37 0.3
38 0.3
39 0.26
40 0.2
41 0.16
42 0.16
43 0.13
44 0.12
45 0.12
46 0.1
47 0.13
48 0.12
49 0.13
50 0.13
51 0.13
52 0.13
53 0.16
54 0.22
55 0.2
56 0.25
57 0.26
58 0.3
59 0.31
60 0.31
61 0.3
62 0.27
63 0.27
64 0.25
65 0.26
66 0.22
67 0.22
68 0.21
69 0.21
70 0.2
71 0.22
72 0.2
73 0.18
74 0.19
75 0.18
76 0.22
77 0.24
78 0.23
79 0.21
80 0.2
81 0.19
82 0.17
83 0.16
84 0.13
85 0.09
86 0.07
87 0.05
88 0.06
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.08
98 0.11
99 0.14
100 0.15
101 0.17
102 0.18
103 0.19
104 0.19
105 0.16
106 0.15
107 0.13
108 0.13
109 0.15
110 0.14
111 0.14
112 0.15
113 0.15
114 0.16
115 0.18
116 0.2
117 0.18
118 0.21
119 0.22
120 0.23
121 0.3
122 0.38
123 0.44
124 0.45
125 0.53
126 0.51
127 0.54
128 0.59
129 0.58
130 0.55
131 0.48
132 0.47
133 0.41
134 0.41
135 0.35
136 0.29
137 0.24
138 0.19
139 0.22
140 0.26
141 0.32
142 0.36
143 0.41
144 0.44
145 0.53
146 0.59
147 0.63
148 0.67
149 0.69
150 0.74
151 0.77
152 0.76
153 0.68
154 0.64
155 0.62
156 0.62
157 0.62
158 0.62
159 0.65
160 0.68
161 0.78
162 0.81
163 0.83
164 0.82
165 0.83
166 0.82
167 0.76
168 0.7
169 0.6
170 0.57
171 0.48
172 0.41
173 0.34
174 0.24
175 0.22
176 0.3
177 0.3
178 0.3
179 0.3
180 0.29
181 0.33
182 0.37
183 0.39
184 0.32
185 0.33
186 0.32
187 0.35
188 0.34
189 0.27
190 0.25
191 0.21
192 0.19
193 0.19
194 0.18
195 0.13