Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163LW52

Protein Details
Accession A0A163LW52    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-94GASPYRKILERKKEEQEKKKTFNPFAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MSTAEPVVSLPTDQSIASNGARVIYDRTTLLALASSQLARVPPNEMAQVPGITKGNNAQDKSAGPALAGASPYRKILERKKEEQEKKKTFNPFALLNEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.13
5 0.14
6 0.13
7 0.13
8 0.13
9 0.13
10 0.14
11 0.12
12 0.14
13 0.12
14 0.13
15 0.12
16 0.12
17 0.11
18 0.09
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.1
29 0.1
30 0.12
31 0.13
32 0.12
33 0.13
34 0.13
35 0.13
36 0.1
37 0.1
38 0.1
39 0.08
40 0.09
41 0.1
42 0.16
43 0.2
44 0.2
45 0.19
46 0.2
47 0.21
48 0.24
49 0.22
50 0.16
51 0.11
52 0.12
53 0.12
54 0.11
55 0.11
56 0.09
57 0.09
58 0.1
59 0.11
60 0.12
61 0.15
62 0.21
63 0.3
64 0.41
65 0.47
66 0.54
67 0.64
68 0.73
69 0.8
70 0.83
71 0.85
72 0.84
73 0.82
74 0.82
75 0.81
76 0.75
77 0.71
78 0.66
79 0.6
80 0.54