Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163K0D5

Protein Details
Accession A0A163K0D5   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
50-80LGDIKQWAGRHRRHRLRYRRRQRRSRSKSRKBasic
NLS Segment(s)
PositionSequence
58-80GRHRRHRLRYRRRQRRSRSKSRK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MWCNGVGNGGEESRQTVSKASAGMDTGIRPKDSALQQYSGYGIYYGRAFLGDIKQWAGRHRRHRLRYRRRQRRSRSKSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.14
5 0.15
6 0.16
7 0.14
8 0.13
9 0.13
10 0.13
11 0.12
12 0.12
13 0.14
14 0.15
15 0.14
16 0.13
17 0.13
18 0.18
19 0.2
20 0.24
21 0.22
22 0.23
23 0.23
24 0.23
25 0.23
26 0.18
27 0.15
28 0.09
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.09
38 0.1
39 0.11
40 0.12
41 0.15
42 0.16
43 0.22
44 0.29
45 0.35
46 0.44
47 0.54
48 0.63
49 0.7
50 0.8
51 0.85
52 0.89
53 0.92
54 0.93
55 0.94
56 0.94
57 0.95
58 0.96
59 0.96
60 0.95