Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163MEC5

Protein Details
Accession A0A163MEC5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-121QIPQVTSASKSKKKNNKKKKGGKHydrophilic
NLS Segment(s)
PositionSequence
108-121KSKKKNNKKKKGGK
Subcellular Location(s) nucl 18, cyto_nucl 13.833, cyto 5.5, cyto_pero 4.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MYITNWDDFQKAAEDIYKASPERTRYVHAFHGSVGELVLTVTNDQTIVKYKTNQATDLKKFIALNASLMSQMQNKAMDVDEPAAPSPSTNTPNAATSPQIPQVTSASKSKKKNNKKKKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.19
4 0.22
5 0.19
6 0.22
7 0.25
8 0.26
9 0.3
10 0.31
11 0.34
12 0.32
13 0.36
14 0.4
15 0.38
16 0.35
17 0.31
18 0.29
19 0.24
20 0.21
21 0.16
22 0.09
23 0.07
24 0.06
25 0.06
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.1
34 0.13
35 0.15
36 0.17
37 0.22
38 0.27
39 0.29
40 0.31
41 0.32
42 0.36
43 0.37
44 0.38
45 0.34
46 0.3
47 0.28
48 0.25
49 0.23
50 0.15
51 0.13
52 0.11
53 0.11
54 0.09
55 0.09
56 0.1
57 0.08
58 0.09
59 0.1
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.11
74 0.14
75 0.17
76 0.17
77 0.19
78 0.19
79 0.21
80 0.23
81 0.22
82 0.19
83 0.18
84 0.21
85 0.24
86 0.24
87 0.22
88 0.22
89 0.25
90 0.27
91 0.28
92 0.32
93 0.35
94 0.42
95 0.5
96 0.59
97 0.66
98 0.74
99 0.82
100 0.86
101 0.88