Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168MI11

Protein Details
Accession A0A168MI11    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-36PSSSSGGKKAKKKWSAKKVKDKANNMVHydrophilic
NLS Segment(s)
PositionSequence
11-31SSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) cyto_nucl 10.166, nucl 10, mito_nucl 9.166, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNMVVLDKPVVSWENWRTFPSAKDGNVRMFDLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.45
4 0.5
5 0.56
6 0.63
7 0.69
8 0.77
9 0.8
10 0.81
11 0.85
12 0.88
13 0.9
14 0.88
15 0.88
16 0.87
17 0.81
18 0.77
19 0.72
20 0.64
21 0.53
22 0.47
23 0.38
24 0.31
25 0.25
26 0.18
27 0.12
28 0.11
29 0.11
30 0.09
31 0.15
32 0.19
33 0.24
34 0.26
35 0.27
36 0.29
37 0.3
38 0.31
39 0.32
40 0.32
41 0.29
42 0.35
43 0.38
44 0.41
45 0.42
46 0.43