Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163IRQ4

Protein Details
Accession A0A163IRQ4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-42FTSDIRQWSSRRHRHRHRYRRRHRRSESKVERKLDBasic
NLS Segment(s)
PositionSequence
18-39RRHRHRHRYRRRHRRSESKVER
Subcellular Location(s) nucl 18, mito_nucl 12.999, cyto_nucl 11.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKNLKTAFTSDIRQWSSRRHRHRHRYRRRHRRSESKVERKLDDVKRSCYSRWQRGEQDAEKRSLTVCSSSFVFRRGRRCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.51
4 0.58
5 0.64
6 0.67
7 0.74
8 0.82
9 0.92
10 0.93
11 0.93
12 0.95
13 0.96
14 0.96
15 0.96
16 0.96
17 0.94
18 0.94
19 0.92
20 0.92
21 0.91
22 0.91
23 0.87
24 0.79
25 0.71
26 0.63
27 0.62
28 0.57
29 0.55
30 0.48
31 0.45
32 0.47
33 0.48
34 0.45
35 0.46
36 0.49
37 0.49
38 0.52
39 0.54
40 0.54
41 0.58
42 0.66
43 0.62
44 0.63
45 0.56
46 0.53
47 0.46
48 0.42
49 0.36
50 0.3
51 0.26
52 0.2
53 0.17
54 0.17
55 0.19
56 0.22
57 0.23
58 0.26
59 0.33
60 0.35