Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168NU96

Protein Details
Accession A0A168NU96    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
141-163TAKTSKKSKITATKKKTTKARLEHydrophilic
NLS Segment(s)
PositionSequence
147-159KSKITATKKKTTK
Subcellular Location(s) mito 14, E.R. 4, nucl 3, cyto 3, plas 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MNERKPRGSLRCRPSVHELVQGSGVYIEPKKPKEKNPEFEAYMERLRAEQQEREYAAMVSSAVQPSNEAYFRPDDIKEMKSHLVTIANIGFSMAAVYVAVYMASRTMLEDLGLRVLLSLAGAFAIGIVETILYVNYTHLFTAKTSKKSKITATKKKTTKARLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.61
4 0.59
5 0.52
6 0.43
7 0.43
8 0.37
9 0.28
10 0.21
11 0.18
12 0.13
13 0.13
14 0.17
15 0.21
16 0.26
17 0.35
18 0.4
19 0.49
20 0.58
21 0.67
22 0.7
23 0.7
24 0.72
25 0.65
26 0.62
27 0.57
28 0.49
29 0.41
30 0.33
31 0.26
32 0.2
33 0.19
34 0.22
35 0.22
36 0.22
37 0.23
38 0.27
39 0.28
40 0.28
41 0.27
42 0.22
43 0.19
44 0.15
45 0.12
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.08
53 0.1
54 0.1
55 0.08
56 0.1
57 0.11
58 0.12
59 0.14
60 0.13
61 0.13
62 0.16
63 0.18
64 0.17
65 0.18
66 0.18
67 0.16
68 0.16
69 0.15
70 0.13
71 0.12
72 0.12
73 0.1
74 0.08
75 0.08
76 0.08
77 0.06
78 0.05
79 0.05
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.03
86 0.03
87 0.02
88 0.02
89 0.03
90 0.03
91 0.03
92 0.04
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.05
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.04
120 0.04
121 0.05
122 0.07
123 0.07
124 0.08
125 0.09
126 0.1
127 0.1
128 0.2
129 0.27
130 0.34
131 0.39
132 0.46
133 0.51
134 0.56
135 0.64
136 0.65
137 0.69
138 0.72
139 0.76
140 0.79
141 0.81
142 0.84
143 0.85