Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163K7S9

Protein Details
Accession A0A163K7S9   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22GVKWREDQKERKSFNRRRLIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MGVKWREDQKERKSFNRRRLIIVTINNFSQQHKITIVTAADVAEERRSRLNKSMHHLAKHNGQIFVMCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.83
4 0.74
5 0.7
6 0.68
7 0.63
8 0.59
9 0.57
10 0.51
11 0.42
12 0.4
13 0.36
14 0.33
15 0.29
16 0.25
17 0.2
18 0.16
19 0.15
20 0.16
21 0.14
22 0.15
23 0.14
24 0.1
25 0.1
26 0.08
27 0.07
28 0.07
29 0.07
30 0.09
31 0.1
32 0.11
33 0.16
34 0.18
35 0.22
36 0.29
37 0.36
38 0.38
39 0.45
40 0.55
41 0.55
42 0.57
43 0.58
44 0.55
45 0.57
46 0.59
47 0.55
48 0.45
49 0.39