Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168S365

Protein Details
Accession A0A168S365   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-43STKTDNEHYRKNVRRKKKPMHTNEDGLHydrophilic
NLS Segment(s)
PositionSequence
29-34VRRKKK
Subcellular Location(s) nucl 8, mito 6, cyto 5, pero 3, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MQLANPFNVYVAVPTLSTKTDNEHYRKNVRRKKKPMHTNEDGLAGNRPVEMLERQWAVEWREDRKERKFLNRRRSIITNITIETAANVAEERRSRFNKHCIILPNIMTKSSNTVVVSIASSLFMLHAINFTRLFLRLGPGATHWGKLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.14
6 0.17
7 0.24
8 0.33
9 0.37
10 0.43
11 0.49
12 0.58
13 0.67
14 0.73
15 0.75
16 0.78
17 0.84
18 0.86
19 0.9
20 0.91
21 0.92
22 0.91
23 0.91
24 0.86
25 0.8
26 0.7
27 0.63
28 0.53
29 0.43
30 0.34
31 0.25
32 0.18
33 0.13
34 0.12
35 0.08
36 0.09
37 0.09
38 0.09
39 0.12
40 0.12
41 0.12
42 0.14
43 0.16
44 0.16
45 0.2
46 0.21
47 0.22
48 0.29
49 0.34
50 0.38
51 0.41
52 0.48
53 0.46
54 0.55
55 0.61
56 0.62
57 0.68
58 0.72
59 0.7
60 0.66
61 0.66
62 0.59
63 0.54
64 0.49
65 0.39
66 0.31
67 0.28
68 0.23
69 0.2
70 0.16
71 0.1
72 0.07
73 0.05
74 0.04
75 0.04
76 0.07
77 0.09
78 0.11
79 0.18
80 0.21
81 0.27
82 0.32
83 0.41
84 0.45
85 0.45
86 0.48
87 0.46
88 0.48
89 0.46
90 0.43
91 0.41
92 0.34
93 0.34
94 0.29
95 0.25
96 0.25
97 0.22
98 0.22
99 0.16
100 0.16
101 0.16
102 0.16
103 0.16
104 0.11
105 0.1
106 0.07
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.07
114 0.09
115 0.12
116 0.12
117 0.13
118 0.14
119 0.15
120 0.16
121 0.14
122 0.16
123 0.16
124 0.17
125 0.18
126 0.18
127 0.24
128 0.24
129 0.25