Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163JLB0

Protein Details
Accession A0A163JLB0   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-44RSFVRSFVRRHRCRHRRLHEVBasic
46-73ESCECRWRNKKVMKKRRRSEEWNWQQNDHydrophilic
NLS Segment(s)
PositionSequence
54-63NKKVMKKRRR
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSKTKSKIKDYQDTEKGRVITIVRSFVRSFVRRHRCRHRRLHEVMESCECRWRNKKVMKKRRRSEEWNWQQNDPCRPFQTPLWSVQVKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.57
4 0.46
5 0.42
6 0.33
7 0.29
8 0.26
9 0.29
10 0.25
11 0.27
12 0.27
13 0.28
14 0.34
15 0.31
16 0.33
17 0.37
18 0.48
19 0.51
20 0.6
21 0.68
22 0.7
23 0.76
24 0.83
25 0.81
26 0.8
27 0.79
28 0.78
29 0.73
30 0.67
31 0.6
32 0.54
33 0.47
34 0.37
35 0.38
36 0.3
37 0.29
38 0.32
39 0.36
40 0.41
41 0.48
42 0.58
43 0.64
44 0.74
45 0.79
46 0.84
47 0.87
48 0.88
49 0.88
50 0.87
51 0.85
52 0.85
53 0.86
54 0.84
55 0.78
56 0.71
57 0.68
58 0.67
59 0.67
60 0.6
61 0.55
62 0.49
63 0.49
64 0.5
65 0.48
66 0.52
67 0.45
68 0.45
69 0.47