Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163J2U7

Protein Details
Accession A0A163J2U7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-35SIDKKSKGGRQRQFSNEQRKDRNRQAQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MTCSTKISIDKKSKGGRQRQFSNEQRKDRNRQAQAAFRERRSKHTKALEDTITDLRTMVQILQQNVMQTKERADKAEKRCQLLEIDCQHMKTTLACLMPQFSPPASLTAYLRSLATRGQQTPNHGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.75
4 0.75
5 0.78
6 0.77
7 0.79
8 0.8
9 0.82
10 0.81
11 0.8
12 0.81
13 0.81
14 0.82
15 0.82
16 0.83
17 0.78
18 0.76
19 0.73
20 0.71
21 0.7
22 0.71
23 0.66
24 0.6
25 0.63
26 0.57
27 0.6
28 0.59
29 0.56
30 0.54
31 0.58
32 0.59
33 0.55
34 0.59
35 0.51
36 0.44
37 0.43
38 0.37
39 0.28
40 0.22
41 0.17
42 0.12
43 0.1
44 0.1
45 0.07
46 0.08
47 0.1
48 0.11
49 0.12
50 0.13
51 0.13
52 0.14
53 0.15
54 0.13
55 0.11
56 0.13
57 0.17
58 0.18
59 0.2
60 0.25
61 0.32
62 0.39
63 0.48
64 0.48
65 0.47
66 0.46
67 0.45
68 0.43
69 0.36
70 0.37
71 0.3
72 0.32
73 0.3
74 0.3
75 0.29
76 0.26
77 0.24
78 0.17
79 0.16
80 0.15
81 0.15
82 0.15
83 0.15
84 0.17
85 0.17
86 0.18
87 0.17
88 0.13
89 0.15
90 0.15
91 0.17
92 0.15
93 0.16
94 0.16
95 0.18
96 0.19
97 0.17
98 0.17
99 0.16
100 0.15
101 0.16
102 0.21
103 0.24
104 0.26
105 0.33
106 0.37