Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168QIF2

Protein Details
Accession A0A168QIF2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-62DKKQCWSRHYFCRRRYRRRHRRSESKVEAKIKDBasic
NLS Segment(s)
PositionSequence
43-64RRYRRRHRRSESKVEAKIKDVK
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 5
Family & Domain DBs
Amino Acid Sequences MVVRTDWVKEWGTLEVQWQRNLQWKTFMGDKKQCWSRHYFCRRRYRRRHRRSESKVEAKIKDVKTIVSHGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.29
4 0.31
5 0.3
6 0.3
7 0.37
8 0.39
9 0.33
10 0.31
11 0.29
12 0.29
13 0.35
14 0.37
15 0.36
16 0.41
17 0.42
18 0.43
19 0.49
20 0.49
21 0.45
22 0.49
23 0.47
24 0.51
25 0.6
26 0.62
27 0.63
28 0.72
29 0.79
30 0.82
31 0.88
32 0.89
33 0.9
34 0.92
35 0.94
36 0.94
37 0.95
38 0.93
39 0.93
40 0.92
41 0.9
42 0.87
43 0.83
44 0.74
45 0.68
46 0.67
47 0.57
48 0.54
49 0.45
50 0.39
51 0.35
52 0.37
53 0.39