Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168PSJ3

Protein Details
Accession A0A168PSJ3    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
14-38ASSTITPTKQIKKSHKQRVKGTSEAHydrophilic
98-131EAKQRYLDAKSKKKNKKHKTKKESTDANKKKVRFBasic
NLS Segment(s)
PositionSequence
101-131QRYLDAKSKKKNKKHKTKKESTDANKKKVRF
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MAKSKTAKPTTKAASSTITPTKQIKKSHKQRVKGTSEADNPKYANKDFMLELITATAAKESQREDQKIAKKMAVEKLIEEKENKKQVKLTAKQKQLEEAKQRYLDAKSKKKNKKHKTKKESTDANKKKVRFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.45
4 0.43
5 0.38
6 0.35
7 0.4
8 0.46
9 0.48
10 0.56
11 0.59
12 0.64
13 0.73
14 0.8
15 0.82
16 0.82
17 0.85
18 0.86
19 0.82
20 0.76
21 0.69
22 0.66
23 0.65
24 0.64
25 0.56
26 0.49
27 0.42
28 0.4
29 0.4
30 0.32
31 0.27
32 0.21
33 0.2
34 0.18
35 0.18
36 0.17
37 0.13
38 0.12
39 0.09
40 0.09
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.06
47 0.08
48 0.14
49 0.19
50 0.21
51 0.24
52 0.3
53 0.36
54 0.41
55 0.4
56 0.35
57 0.31
58 0.34
59 0.37
60 0.34
61 0.27
62 0.23
63 0.28
64 0.28
65 0.28
66 0.26
67 0.25
68 0.29
69 0.38
70 0.37
71 0.32
72 0.34
73 0.4
74 0.48
75 0.53
76 0.56
77 0.56
78 0.63
79 0.67
80 0.64
81 0.65
82 0.61
83 0.61
84 0.6
85 0.56
86 0.54
87 0.51
88 0.51
89 0.47
90 0.45
91 0.44
92 0.45
93 0.5
94 0.54
95 0.64
96 0.73
97 0.8
98 0.86
99 0.89
100 0.91
101 0.92
102 0.93
103 0.94
104 0.95
105 0.95
106 0.94
107 0.94
108 0.92
109 0.92
110 0.9
111 0.89
112 0.85