Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163JY10

Protein Details
Accession A0A163JY10   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
118-142AEPVRKYNLRRLGRKKNPRGENEPAHydrophilic
NLS Segment(s)
PositionSequence
122-136RKYNLRRLGRKKNPR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.166, mito_nucl 9.499, cyto_mito 5.999, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MQNEERRRRSIADSSRLSLHSASPPPKETSIWWYFPLWFFFKPAGSSAAPSISSSPQQTTNIQGSMKSNKSNSSRKMSCHRDDVSVISTPPTPPPEPPTSLDLTPPKPPPIEPPSPPAEPVRKYNLRRLGRKKNPRGENEPAILLIPPFSPTYCKPNEFPYSNFYLKLPNGRWMLRYRSGTRHIIGTQDLEGYMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.54
4 0.49
5 0.4
6 0.33
7 0.31
8 0.33
9 0.36
10 0.36
11 0.39
12 0.4
13 0.41
14 0.4
15 0.35
16 0.37
17 0.38
18 0.36
19 0.35
20 0.32
21 0.33
22 0.33
23 0.35
24 0.3
25 0.24
26 0.23
27 0.23
28 0.22
29 0.21
30 0.2
31 0.2
32 0.17
33 0.18
34 0.17
35 0.17
36 0.16
37 0.15
38 0.16
39 0.14
40 0.16
41 0.16
42 0.17
43 0.18
44 0.2
45 0.21
46 0.23
47 0.24
48 0.24
49 0.22
50 0.22
51 0.22
52 0.27
53 0.28
54 0.27
55 0.25
56 0.3
57 0.36
58 0.43
59 0.45
60 0.47
61 0.47
62 0.49
63 0.57
64 0.59
65 0.56
66 0.55
67 0.51
68 0.44
69 0.42
70 0.39
71 0.32
72 0.25
73 0.22
74 0.16
75 0.15
76 0.12
77 0.13
78 0.15
79 0.14
80 0.13
81 0.19
82 0.21
83 0.23
84 0.25
85 0.26
86 0.25
87 0.24
88 0.27
89 0.25
90 0.24
91 0.26
92 0.26
93 0.24
94 0.22
95 0.23
96 0.26
97 0.3
98 0.33
99 0.3
100 0.33
101 0.36
102 0.36
103 0.37
104 0.34
105 0.33
106 0.3
107 0.32
108 0.36
109 0.4
110 0.42
111 0.49
112 0.55
113 0.57
114 0.64
115 0.7
116 0.73
117 0.75
118 0.84
119 0.85
120 0.85
121 0.86
122 0.83
123 0.81
124 0.78
125 0.73
126 0.64
127 0.54
128 0.44
129 0.36
130 0.29
131 0.21
132 0.14
133 0.09
134 0.08
135 0.08
136 0.09
137 0.12
138 0.14
139 0.22
140 0.26
141 0.29
142 0.29
143 0.36
144 0.44
145 0.44
146 0.43
147 0.41
148 0.44
149 0.42
150 0.41
151 0.34
152 0.32
153 0.31
154 0.37
155 0.34
156 0.35
157 0.38
158 0.38
159 0.42
160 0.42
161 0.47
162 0.46
163 0.51
164 0.49
165 0.53
166 0.58
167 0.59
168 0.55
169 0.53
170 0.46
171 0.42
172 0.39
173 0.33
174 0.27
175 0.23