Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168P1M0

Protein Details
Accession A0A168P1M0    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-51MDIQWASRHCRHRRRYRRRHRRSRSNVENKMLVHydrophilic
NLS Segment(s)
PositionSequence
29-42RHRRRYRRRHRRSR
Subcellular Location(s) nucl 24, mito 1, cyto 1, golg 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MGQNGNRGPSKQHFEALGMDIQWASRHCRHRRRYRRRHRRSRSNVENKMLVMVKLSPSAQNPTMDDTMAGELTSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.33
4 0.27
5 0.19
6 0.17
7 0.14
8 0.13
9 0.13
10 0.11
11 0.14
12 0.2
13 0.29
14 0.38
15 0.48
16 0.58
17 0.68
18 0.78
19 0.84
20 0.89
21 0.91
22 0.94
23 0.95
24 0.96
25 0.96
26 0.96
27 0.95
28 0.94
29 0.94
30 0.93
31 0.89
32 0.81
33 0.72
34 0.6
35 0.53
36 0.43
37 0.31
38 0.22
39 0.16
40 0.13
41 0.14
42 0.14
43 0.13
44 0.15
45 0.2
46 0.21
47 0.23
48 0.23
49 0.26
50 0.27
51 0.25
52 0.22
53 0.19
54 0.18
55 0.16