Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168RBN1

Protein Details
Accession A0A168RBN1   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-50SFTLRGKTPGYKRTRRSRTFHydrophilic
200-222IDEQNKKPKRQGLKKRTSRLSGLHydrophilic
NLS Segment(s)
PositionSequence
205-215KKPKRQGLKKR
Subcellular Location(s) nucl 21, cyto_nucl 15.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006015  Universal_stress_UspA  
IPR006016  UspA  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MSATPSSGSSDNYVRVVSFDTMTDKDLPDYSFTLRGKTPGYKRTRRSRTFLVATDLASYSDHALHWTINDITDDGDELVVLRVVSVDMNDKKSVVEATLKREEQRAREEATKVMERIMATGNEDNKISVVIEFVIGKVQHTIQHMITMYQPSLLVVGTRGLSEFQGLVIGSVSKYCLQHSPIPVVVVRPQDSVKKQLRNIDEQNKKPKRQGLKKRTSRLSGLFSRSSSPAASDNNEDSGDSDGEQQATTQQMKHLSVEGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.18
5 0.16
6 0.15
7 0.18
8 0.18
9 0.21
10 0.22
11 0.19
12 0.19
13 0.21
14 0.21
15 0.19
16 0.2
17 0.2
18 0.26
19 0.25
20 0.27
21 0.26
22 0.28
23 0.29
24 0.36
25 0.41
26 0.43
27 0.52
28 0.58
29 0.66
30 0.75
31 0.81
32 0.79
33 0.79
34 0.78
35 0.77
36 0.74
37 0.67
38 0.63
39 0.53
40 0.47
41 0.41
42 0.33
43 0.24
44 0.19
45 0.16
46 0.11
47 0.11
48 0.1
49 0.09
50 0.1
51 0.09
52 0.09
53 0.11
54 0.1
55 0.1
56 0.11
57 0.1
58 0.1
59 0.1
60 0.1
61 0.07
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.11
74 0.13
75 0.16
76 0.16
77 0.16
78 0.16
79 0.17
80 0.17
81 0.12
82 0.17
83 0.16
84 0.23
85 0.29
86 0.3
87 0.3
88 0.35
89 0.37
90 0.33
91 0.37
92 0.33
93 0.3
94 0.33
95 0.34
96 0.3
97 0.31
98 0.29
99 0.23
100 0.21
101 0.19
102 0.15
103 0.15
104 0.15
105 0.11
106 0.11
107 0.13
108 0.14
109 0.13
110 0.13
111 0.11
112 0.1
113 0.1
114 0.08
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.09
127 0.11
128 0.13
129 0.12
130 0.14
131 0.14
132 0.14
133 0.15
134 0.13
135 0.12
136 0.1
137 0.1
138 0.07
139 0.07
140 0.06
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.06
160 0.08
161 0.08
162 0.1
163 0.13
164 0.16
165 0.21
166 0.24
167 0.26
168 0.25
169 0.26
170 0.25
171 0.24
172 0.24
173 0.23
174 0.23
175 0.2
176 0.21
177 0.26
178 0.29
179 0.36
180 0.4
181 0.43
182 0.45
183 0.5
184 0.54
185 0.56
186 0.62
187 0.63
188 0.65
189 0.66
190 0.73
191 0.75
192 0.74
193 0.72
194 0.71
195 0.72
196 0.73
197 0.77
198 0.77
199 0.8
200 0.86
201 0.89
202 0.89
203 0.83
204 0.79
205 0.73
206 0.7
207 0.66
208 0.61
209 0.55
210 0.48
211 0.46
212 0.41
213 0.37
214 0.29
215 0.24
216 0.22
217 0.22
218 0.24
219 0.25
220 0.26
221 0.27
222 0.27
223 0.24
224 0.21
225 0.21
226 0.18
227 0.15
228 0.16
229 0.15
230 0.15
231 0.15
232 0.14
233 0.14
234 0.18
235 0.19
236 0.18
237 0.2
238 0.25
239 0.27
240 0.28