Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163MQ68

Protein Details
Accession A0A163MQ68    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-75RRRGKLFVVCSKNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSLLKSLLQQTRPMLGLFQQQQQPFVNTLPMMTVIRTMKVRSSVKKLCDGCTSVRRRGKLFVVCSKNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.27
4 0.25
5 0.29
6 0.31
7 0.3
8 0.33
9 0.33
10 0.33
11 0.26
12 0.24
13 0.2
14 0.14
15 0.14
16 0.11
17 0.12
18 0.1
19 0.08
20 0.11
21 0.1
22 0.12
23 0.12
24 0.12
25 0.12
26 0.19
27 0.23
28 0.24
29 0.32
30 0.36
31 0.37
32 0.46
33 0.46
34 0.42
35 0.42
36 0.41
37 0.38
38 0.42
39 0.45
40 0.46
41 0.5
42 0.5
43 0.48
44 0.51
45 0.53
46 0.51
47 0.52
48 0.53
49 0.57
50 0.62
51 0.68
52 0.73
53 0.77
54 0.79
55 0.83