Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163KMK0

Protein Details
Accession A0A163KMK0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-71VRSFVIVIARRRRRRRRRLRRSRVKVVGKIKVMKKQRRSKKKNWRGKNMVIGPKCBasic
NLS Segment(s)
PositionSequence
26-63RRRRRRRRRLRRSRVKVVGKIKVMKKQRRSKKKNWRGK
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MNKTLRREELPFVRSFVRSFVIVIARRRRRRRRRLRRSRVKVVGKIKVMKKQRRSKKKNWRGKNMVIGPKCGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.29
4 0.22
5 0.18
6 0.17
7 0.17
8 0.21
9 0.24
10 0.3
11 0.38
12 0.46
13 0.55
14 0.65
15 0.73
16 0.78
17 0.85
18 0.9
19 0.91
20 0.93
21 0.95
22 0.96
23 0.97
24 0.95
25 0.93
26 0.92
27 0.88
28 0.84
29 0.8
30 0.75
31 0.68
32 0.66
33 0.61
34 0.59
35 0.61
36 0.63
37 0.66
38 0.69
39 0.75
40 0.8
41 0.85
42 0.88
43 0.89
44 0.91
45 0.92
46 0.92
47 0.92
48 0.9
49 0.89
50 0.89
51 0.87
52 0.86
53 0.77