Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168L693

Protein Details
Accession A0A168L693   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-49MGHRHHHRLLKYRLWKHKKRLRKMSPSDQKYEBasic
NLS Segment(s)
PositionSequence
25-40RLLKYRLWKHKKRLRK
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
Amino Acid Sequences MTRTKVKRVKTEADNVLMGHRHHHRLLKYRLWKHKKRLRKMSPSDQKYEYEKAKVASIVSELAASKSLIAAAKRSNRQHDDEDEDDDDAPSDNEDNLASTDDDLADDLADNQYEEPSAATIKKVCGLIVDLLRKKDEDYCINTNDLLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.5
3 0.46
4 0.4
5 0.33
6 0.29
7 0.29
8 0.29
9 0.32
10 0.38
11 0.4
12 0.47
13 0.55
14 0.59
15 0.64
16 0.69
17 0.76
18 0.8
19 0.83
20 0.84
21 0.86
22 0.87
23 0.87
24 0.89
25 0.88
26 0.89
27 0.89
28 0.89
29 0.91
30 0.85
31 0.8
32 0.71
33 0.64
34 0.58
35 0.54
36 0.46
37 0.38
38 0.35
39 0.3
40 0.29
41 0.26
42 0.21
43 0.16
44 0.14
45 0.11
46 0.09
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.12
59 0.18
60 0.24
61 0.27
62 0.32
63 0.34
64 0.38
65 0.39
66 0.38
67 0.39
68 0.34
69 0.34
70 0.29
71 0.26
72 0.22
73 0.19
74 0.16
75 0.1
76 0.08
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.05
103 0.06
104 0.08
105 0.08
106 0.1
107 0.11
108 0.12
109 0.16
110 0.16
111 0.15
112 0.14
113 0.16
114 0.19
115 0.23
116 0.31
117 0.32
118 0.33
119 0.35
120 0.34
121 0.34
122 0.35
123 0.35
124 0.33
125 0.37
126 0.4
127 0.42
128 0.43
129 0.42