Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163IUE6

Protein Details
Accession A0A163IUE6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-69ERYQQWASRHRRHRLRYRRRHHRSRSKCRKQNAGHGKLKDBasic
NLS Segment(s)
PositionSequence
38-68RHRRHRLRYRRRHHRSRSKCRKQNAGHGKLK
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPGLPTLKVTVAGLGPDAVFRERRVKVIWERYQQWASRHRRHRLRYRRRHHRSRSKCRKQNAGHGKLKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.09
5 0.09
6 0.1
7 0.11
8 0.19
9 0.19
10 0.21
11 0.23
12 0.28
13 0.34
14 0.43
15 0.49
16 0.48
17 0.49
18 0.52
19 0.54
20 0.51
21 0.47
22 0.46
23 0.47
24 0.51
25 0.57
26 0.62
27 0.67
28 0.73
29 0.8
30 0.81
31 0.84
32 0.86
33 0.88
34 0.9
35 0.92
36 0.94
37 0.94
38 0.94
39 0.94
40 0.94
41 0.95
42 0.95
43 0.93
44 0.91
45 0.9
46 0.86
47 0.86
48 0.86
49 0.84