Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168QN15

Protein Details
Accession A0A168QN15    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-97CDIKQWASRHRRHCLRYRRRHRLSRDLKSKRBasic
NLS Segment(s)
PositionSequence
82-97RYRRRHRLSRDLKSKR
Subcellular Location(s) nucl 18, mito_nucl 11.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MHCNPLPGWNSNPPRFKAGPEFRGEEKLTEFKNAVTSVVMNTGIRPKDSALQQCNGYGIYNGRALSCDIKQWASRHRRHCLRYRRRHRLSRDLKSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.53
4 0.54
5 0.54
6 0.52
7 0.5
8 0.52
9 0.47
10 0.52
11 0.48
12 0.39
13 0.33
14 0.32
15 0.28
16 0.26
17 0.25
18 0.19
19 0.22
20 0.2
21 0.17
22 0.13
23 0.12
24 0.1
25 0.11
26 0.11
27 0.08
28 0.08
29 0.12
30 0.12
31 0.12
32 0.12
33 0.12
34 0.15
35 0.19
36 0.25
37 0.23
38 0.24
39 0.25
40 0.24
41 0.24
42 0.2
43 0.17
44 0.11
45 0.1
46 0.09
47 0.11
48 0.11
49 0.1
50 0.11
51 0.12
52 0.14
53 0.14
54 0.14
55 0.14
56 0.17
57 0.21
58 0.23
59 0.32
60 0.39
61 0.47
62 0.52
63 0.61
64 0.68
65 0.72
66 0.79
67 0.8
68 0.82
69 0.85
70 0.88
71 0.89
72 0.9
73 0.92
74 0.91
75 0.91
76 0.91
77 0.91