Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168L4X4

Protein Details
Accession A0A168L4X4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-87KMPQFITSSRRRRRVRVHHDRNVPSRHHBasic
NLS Segment(s)
PositionSequence
71-73RRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences MQDAEAGQASDYNKRRHVIRLRIQQGPQFLIRTKGEDDQLVWIEHLQASVNVSLDLDTRKMPQFITSSRRRRRVRVHHDRNVPSRHHQREGALI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.45
4 0.53
5 0.55
6 0.59
7 0.65
8 0.66
9 0.7
10 0.7
11 0.63
12 0.57
13 0.49
14 0.41
15 0.33
16 0.28
17 0.27
18 0.25
19 0.24
20 0.24
21 0.23
22 0.22
23 0.2
24 0.19
25 0.17
26 0.18
27 0.16
28 0.13
29 0.11
30 0.1
31 0.1
32 0.09
33 0.06
34 0.05
35 0.05
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.07
43 0.07
44 0.07
45 0.1
46 0.11
47 0.12
48 0.12
49 0.15
50 0.18
51 0.22
52 0.29
53 0.37
54 0.46
55 0.55
56 0.65
57 0.66
58 0.71
59 0.77
60 0.8
61 0.82
62 0.83
63 0.84
64 0.84
65 0.89
66 0.89
67 0.86
68 0.81
69 0.75
70 0.73
71 0.73
72 0.71
73 0.67
74 0.62