Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163ITU9

Protein Details
Accession A0A163ITU9   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-66LHPSTPTRAQQQRHRRNLRLNGQVDHydrophilic
296-325DDALSLEKEKKDRRRQRQQQRKQQLDGYACHydrophilic
NLS Segment(s)
PositionSequence
308-309RR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MVDKKEQQSETPPDGSPPSLRQDDQSKRSDREQQSSNEVHPLHPSTPTRAQQQRHRRNLRLNGQVDVEEGSTARYSLSNERRDSWIDRINSSTKNAIRRTSTIATIDEKKLIDKVADSLNQYGEEHTHDSWADKVMDFLFPSIAENSDSDSDNKQVAKEMTPFYYSPSPFNGQRTPVMSPSDKSYDKAQLTEPQADLKSWAIGTTDTMDVVDQRALNQHPHLGMTAQTSDQAYDEAQSTYPDEQSVQYYADALEEQDQHDPPSPRKPSFSVKDELKSKQEQHLWPPVQSVDQTPDDDALSLEKEKKDRRRQRQQQRKQQLDGYAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.35
4 0.32
5 0.33
6 0.34
7 0.34
8 0.36
9 0.44
10 0.51
11 0.54
12 0.59
13 0.58
14 0.58
15 0.64
16 0.69
17 0.65
18 0.64
19 0.63
20 0.59
21 0.6
22 0.6
23 0.55
24 0.51
25 0.45
26 0.38
27 0.37
28 0.36
29 0.29
30 0.32
31 0.33
32 0.33
33 0.41
34 0.44
35 0.49
36 0.52
37 0.58
38 0.62
39 0.72
40 0.75
41 0.78
42 0.83
43 0.81
44 0.83
45 0.86
46 0.85
47 0.83
48 0.74
49 0.66
50 0.58
51 0.5
52 0.41
53 0.32
54 0.23
55 0.13
56 0.11
57 0.1
58 0.08
59 0.08
60 0.08
61 0.07
62 0.1
63 0.19
64 0.28
65 0.34
66 0.36
67 0.38
68 0.41
69 0.44
70 0.45
71 0.42
72 0.41
73 0.35
74 0.35
75 0.36
76 0.38
77 0.36
78 0.34
79 0.35
80 0.31
81 0.37
82 0.39
83 0.39
84 0.38
85 0.39
86 0.43
87 0.39
88 0.37
89 0.31
90 0.3
91 0.3
92 0.31
93 0.3
94 0.25
95 0.23
96 0.21
97 0.2
98 0.19
99 0.15
100 0.11
101 0.12
102 0.14
103 0.16
104 0.17
105 0.17
106 0.17
107 0.18
108 0.17
109 0.15
110 0.12
111 0.12
112 0.13
113 0.12
114 0.12
115 0.11
116 0.12
117 0.12
118 0.14
119 0.12
120 0.09
121 0.1
122 0.1
123 0.11
124 0.1
125 0.09
126 0.07
127 0.06
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.09
135 0.1
136 0.11
137 0.11
138 0.12
139 0.13
140 0.13
141 0.12
142 0.13
143 0.13
144 0.14
145 0.16
146 0.17
147 0.16
148 0.18
149 0.17
150 0.18
151 0.22
152 0.21
153 0.19
154 0.2
155 0.22
156 0.22
157 0.26
158 0.25
159 0.22
160 0.24
161 0.25
162 0.23
163 0.23
164 0.24
165 0.21
166 0.2
167 0.21
168 0.25
169 0.23
170 0.23
171 0.24
172 0.27
173 0.27
174 0.28
175 0.26
176 0.27
177 0.3
178 0.31
179 0.28
180 0.24
181 0.24
182 0.22
183 0.21
184 0.15
185 0.13
186 0.1
187 0.1
188 0.07
189 0.07
190 0.08
191 0.09
192 0.09
193 0.07
194 0.08
195 0.07
196 0.07
197 0.08
198 0.09
199 0.07
200 0.07
201 0.11
202 0.12
203 0.14
204 0.15
205 0.16
206 0.15
207 0.15
208 0.15
209 0.12
210 0.12
211 0.12
212 0.12
213 0.1
214 0.11
215 0.11
216 0.11
217 0.1
218 0.1
219 0.08
220 0.08
221 0.09
222 0.08
223 0.08
224 0.09
225 0.11
226 0.12
227 0.12
228 0.11
229 0.11
230 0.11
231 0.13
232 0.14
233 0.13
234 0.11
235 0.11
236 0.11
237 0.11
238 0.1
239 0.08
240 0.1
241 0.1
242 0.12
243 0.15
244 0.15
245 0.16
246 0.23
247 0.26
248 0.26
249 0.35
250 0.41
251 0.4
252 0.44
253 0.47
254 0.5
255 0.55
256 0.57
257 0.54
258 0.53
259 0.59
260 0.61
261 0.61
262 0.57
263 0.56
264 0.55
265 0.55
266 0.58
267 0.54
268 0.55
269 0.61
270 0.58
271 0.51
272 0.5
273 0.43
274 0.38
275 0.34
276 0.3
277 0.25
278 0.25
279 0.26
280 0.24
281 0.24
282 0.21
283 0.2
284 0.18
285 0.14
286 0.14
287 0.16
288 0.2
289 0.23
290 0.3
291 0.39
292 0.5
293 0.59
294 0.68
295 0.76
296 0.82
297 0.89
298 0.93
299 0.95
300 0.96
301 0.96
302 0.96
303 0.94
304 0.89
305 0.84