Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168PFC6

Protein Details
Accession A0A168PFC6   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-46LKVDLRQLSSRHRRRRHRYRRRHRRSGSSVQKKMKBasic
NLS Segment(s)
PositionSequence
21-43SRHRRRRHRYRRRHRRSGSSVQK
Subcellular Location(s) mito_nucl 13.166, nucl 12.5, mito 12.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MFLHQKNFKTALKVDLRQLSSRHRRRRHRYRRRHRRSGSSVQKKMKDVFVGHGKQEDAEKKSLTVCPSSSVFRCRRRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.49
4 0.47
5 0.48
6 0.49
7 0.52
8 0.59
9 0.63
10 0.66
11 0.74
12 0.81
13 0.9
14 0.91
15 0.92
16 0.93
17 0.94
18 0.96
19 0.96
20 0.96
21 0.91
22 0.9
23 0.87
24 0.86
25 0.86
26 0.85
27 0.82
28 0.77
29 0.74
30 0.66
31 0.59
32 0.51
33 0.43
34 0.34
35 0.32
36 0.34
37 0.32
38 0.3
39 0.3
40 0.27
41 0.25
42 0.29
43 0.29
44 0.24
45 0.25
46 0.25
47 0.23
48 0.26
49 0.29
50 0.27
51 0.24
52 0.21
53 0.22
54 0.24
55 0.29
56 0.3
57 0.36
58 0.42
59 0.49
60 0.6