Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168LF07

Protein Details
Accession A0A168LF07   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-57ERLRGNMIRLRKRKRKFEALLCCLHydrophilic
149-172GFDRYRKQYLARKKARQQSNKKAAHydrophilic
NLS Segment(s)
PositionSequence
42-49RLRKRKRK
161-164KKAR
Subcellular Location(s) plas 14, nucl 7, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019168  NEP1-R1  
IPR005605  Spo7  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0071595  C:Nem1-Spo7 phosphatase complex  
GO:0031965  C:nuclear membrane  
GO:0019888  F:protein phosphatase regulator activity  
GO:0006629  P:lipid metabolic process  
GO:0035307  P:positive regulation of protein dephosphorylation  
Pfam View protein in Pfam  
PF03907  Spo7  
Amino Acid Sequences MNDSLPEKVTSPNSPDPSTKYDQVTYRDLVIFEERLRGNMIRLRKRKRKFEALLCCLLALLGYFFYAVFVDPSKTFTNHLMNTMALLVVAGSLVFFYRSGMYSEKIMYAAQFVPHCNRALSSFNLQFNRRGESGELNFYPMIPKQLQDGFDRYRKQYLARKKARQQSNKKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.46
4 0.49
5 0.51
6 0.48
7 0.43
8 0.43
9 0.45
10 0.47
11 0.46
12 0.4
13 0.37
14 0.34
15 0.3
16 0.27
17 0.25
18 0.22
19 0.18
20 0.23
21 0.2
22 0.19
23 0.22
24 0.2
25 0.21
26 0.23
27 0.32
28 0.36
29 0.46
30 0.55
31 0.62
32 0.71
33 0.78
34 0.82
35 0.84
36 0.82
37 0.82
38 0.83
39 0.78
40 0.74
41 0.63
42 0.54
43 0.43
44 0.34
45 0.24
46 0.13
47 0.07
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.07
58 0.07
59 0.11
60 0.12
61 0.12
62 0.14
63 0.17
64 0.21
65 0.2
66 0.22
67 0.19
68 0.18
69 0.17
70 0.16
71 0.12
72 0.06
73 0.05
74 0.03
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.03
83 0.03
84 0.04
85 0.05
86 0.07
87 0.09
88 0.1
89 0.11
90 0.12
91 0.11
92 0.11
93 0.11
94 0.09
95 0.09
96 0.09
97 0.11
98 0.11
99 0.12
100 0.15
101 0.17
102 0.18
103 0.16
104 0.16
105 0.17
106 0.2
107 0.22
108 0.25
109 0.28
110 0.32
111 0.36
112 0.37
113 0.39
114 0.37
115 0.39
116 0.32
117 0.29
118 0.26
119 0.28
120 0.29
121 0.3
122 0.29
123 0.27
124 0.26
125 0.24
126 0.25
127 0.19
128 0.21
129 0.15
130 0.16
131 0.18
132 0.22
133 0.24
134 0.26
135 0.31
136 0.33
137 0.39
138 0.44
139 0.43
140 0.45
141 0.45
142 0.48
143 0.52
144 0.57
145 0.61
146 0.66
147 0.74
148 0.77
149 0.85
150 0.88
151 0.9
152 0.9