Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163JJX0

Protein Details
Accession A0A163JJX0   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-120QKYLETSKKAKDRRLRQRRLRLLAKNKPHydrophilic
NLS Segment(s)
PositionSequence
100-120KKAKDRRLRQRRLRLLAKNKP
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Amino Acid Sequences MLKSTLILFRPTLQCCHASVLSRSSFSPSTATPHQRHHDSPFIVTPASLPFTTPSNNAFHPAHLPHRTKVRLTLDELDQVLASSKQLLHHLQQKYLETSKKAKDRRLRQRRLRLLAKNKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.35
4 0.31
5 0.28
6 0.28
7 0.31
8 0.3
9 0.29
10 0.28
11 0.27
12 0.26
13 0.23
14 0.23
15 0.18
16 0.22
17 0.28
18 0.36
19 0.34
20 0.41
21 0.46
22 0.48
23 0.5
24 0.49
25 0.49
26 0.43
27 0.42
28 0.36
29 0.31
30 0.27
31 0.23
32 0.19
33 0.13
34 0.14
35 0.11
36 0.09
37 0.09
38 0.11
39 0.12
40 0.12
41 0.13
42 0.13
43 0.14
44 0.18
45 0.17
46 0.16
47 0.17
48 0.18
49 0.22
50 0.26
51 0.29
52 0.27
53 0.34
54 0.36
55 0.34
56 0.39
57 0.39
58 0.35
59 0.36
60 0.37
61 0.31
62 0.32
63 0.31
64 0.25
65 0.18
66 0.15
67 0.13
68 0.09
69 0.08
70 0.06
71 0.07
72 0.08
73 0.12
74 0.14
75 0.18
76 0.26
77 0.28
78 0.3
79 0.33
80 0.34
81 0.36
82 0.4
83 0.4
84 0.37
85 0.42
86 0.47
87 0.52
88 0.56
89 0.61
90 0.65
91 0.72
92 0.79
93 0.83
94 0.86
95 0.87
96 0.92
97 0.93
98 0.93
99 0.91
100 0.91