Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168RML5

Protein Details
Accession A0A168RML5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-78DIKQWASRHRRLRLRYRRRHRRSRDLKSKRKCWLWBasic
NLS Segment(s)
PositionSequence
51-74RHRRLRLRYRRRHRRSRDLKSKRK
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MILPFRSVMAMESTMDEVSARKKKFKGFPLFFIFENFKTALSCDIKQWASRHRRLRLRYRRRHRRSRDLKSKRKCWLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.09
5 0.16
6 0.23
7 0.24
8 0.28
9 0.32
10 0.4
11 0.48
12 0.56
13 0.6
14 0.56
15 0.61
16 0.63
17 0.61
18 0.54
19 0.49
20 0.41
21 0.31
22 0.29
23 0.22
24 0.15
25 0.13
26 0.13
27 0.14
28 0.15
29 0.15
30 0.14
31 0.18
32 0.18
33 0.22
34 0.24
35 0.29
36 0.35
37 0.43
38 0.51
39 0.56
40 0.63
41 0.68
42 0.77
43 0.79
44 0.81
45 0.84
46 0.87
47 0.9
48 0.91
49 0.94
50 0.93
51 0.93
52 0.93
53 0.94
54 0.94
55 0.93
56 0.94
57 0.94
58 0.93