Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168KVZ3

Protein Details
Accession A0A168KVZ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRHPLKFKSKRKQLAELQEDTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 5, E.R. 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044234  TMEM230  
IPR008590  TMEM_230/134  
Gene Ontology GO:0005776  C:autophagosome  
GO:0005769  C:early endosome  
GO:0005794  C:Golgi apparatus  
GO:0005770  C:late endosome  
GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05915  TMEM_230_134  
Amino Acid Sequences MRHPLKFKSKRKQLAELQEDTGFSAEQFTPPEAQIPWKAIGLATLLFGIGSILIVVGVLIYLGFITTEDYLGRSIPLLVLGSIMFIPGAYHLYIAYYAYYKYPGYEFSMIPDWED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.73
4 0.66
5 0.57
6 0.5
7 0.41
8 0.32
9 0.21
10 0.14
11 0.13
12 0.1
13 0.1
14 0.11
15 0.12
16 0.13
17 0.13
18 0.15
19 0.12
20 0.16
21 0.16
22 0.18
23 0.18
24 0.16
25 0.16
26 0.14
27 0.14
28 0.12
29 0.1
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.01
45 0.01
46 0.01
47 0.01
48 0.01
49 0.01
50 0.02
51 0.02
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.09
86 0.11
87 0.11
88 0.12
89 0.13
90 0.14
91 0.2
92 0.22
93 0.21
94 0.24
95 0.3