Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163KSK7

Protein Details
Accession A0A163KSK7   
Localization Confidence High
Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
151-170NGTAKRPKHKPKVDTDRQQQHydrophilic
192-211NGTPRRPKHKSKADPYQQPVHydrophilic
249-280GLFGKHREPSQPKKQRNKRQRQTSIDDQQQPSHydrophilic
309-336EEDPGTRKIKKQQQRRRKHTLANGFSGFHydrophilic
NLS Segment(s)
PositionSequence
156-160RPKHK
261-266KKQRNK
316-326KIKKQQQRRRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSNQRSHQTHSAPLNGWDSYFSSRASSLLESSNNKRHPCTDATSIRKRSRLVEVGTSSKRKDMLPASIPTLTSTVPRVSSRPRSTLEGTSSASSIHKGGSIDSILKRMELPSTQQPRIVKRNATMATSLYPQQDGNSSDESIDTYLKRIENGTAKRPKHKPKVDTDRQQQQQQEDDNDSDESIETYLERIDNGTPRRPKHKSKADPYQQPVDDDLPLSDTTTPQPCTTTTQEDTVTQAATMSSDDTYYGLFGKHREPSQPKKQRNKRQRQTSIDDQQQPSLDMKTILEAISVEPLPKSVLNNELDFFAEEDPGTRKIKKQQQRRRKHTLANGFSGFSDEEEGSSDDALD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.38
3 0.34
4 0.28
5 0.26
6 0.24
7 0.24
8 0.2
9 0.19
10 0.19
11 0.19
12 0.2
13 0.19
14 0.17
15 0.2
16 0.25
17 0.29
18 0.35
19 0.44
20 0.48
21 0.49
22 0.49
23 0.48
24 0.48
25 0.47
26 0.46
27 0.47
28 0.5
29 0.57
30 0.64
31 0.7
32 0.71
33 0.7
34 0.66
35 0.61
36 0.6
37 0.58
38 0.52
39 0.51
40 0.5
41 0.53
42 0.58
43 0.58
44 0.5
45 0.45
46 0.43
47 0.35
48 0.37
49 0.34
50 0.35
51 0.37
52 0.39
53 0.4
54 0.39
55 0.39
56 0.33
57 0.3
58 0.22
59 0.17
60 0.17
61 0.15
62 0.17
63 0.18
64 0.21
65 0.27
66 0.37
67 0.41
68 0.44
69 0.45
70 0.47
71 0.5
72 0.51
73 0.47
74 0.4
75 0.37
76 0.33
77 0.3
78 0.25
79 0.22
80 0.17
81 0.14
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.12
88 0.15
89 0.15
90 0.18
91 0.16
92 0.16
93 0.16
94 0.15
95 0.16
96 0.13
97 0.17
98 0.24
99 0.31
100 0.32
101 0.35
102 0.38
103 0.42
104 0.49
105 0.49
106 0.42
107 0.37
108 0.45
109 0.43
110 0.41
111 0.35
112 0.28
113 0.25
114 0.24
115 0.24
116 0.16
117 0.15
118 0.14
119 0.13
120 0.15
121 0.15
122 0.16
123 0.16
124 0.15
125 0.14
126 0.15
127 0.14
128 0.12
129 0.12
130 0.09
131 0.08
132 0.11
133 0.11
134 0.11
135 0.12
136 0.14
137 0.2
138 0.24
139 0.32
140 0.38
141 0.4
142 0.48
143 0.56
144 0.63
145 0.66
146 0.7
147 0.68
148 0.69
149 0.78
150 0.8
151 0.8
152 0.78
153 0.77
154 0.73
155 0.71
156 0.63
157 0.54
158 0.48
159 0.41
160 0.35
161 0.28
162 0.24
163 0.2
164 0.18
165 0.16
166 0.12
167 0.1
168 0.08
169 0.06
170 0.05
171 0.04
172 0.04
173 0.05
174 0.05
175 0.04
176 0.05
177 0.07
178 0.12
179 0.15
180 0.22
181 0.27
182 0.3
183 0.39
184 0.45
185 0.52
186 0.57
187 0.65
188 0.68
189 0.71
190 0.79
191 0.79
192 0.82
193 0.77
194 0.74
195 0.64
196 0.56
197 0.49
198 0.39
199 0.3
200 0.22
201 0.18
202 0.12
203 0.11
204 0.11
205 0.09
206 0.08
207 0.11
208 0.14
209 0.16
210 0.14
211 0.15
212 0.16
213 0.21
214 0.24
215 0.27
216 0.25
217 0.26
218 0.27
219 0.26
220 0.27
221 0.23
222 0.19
223 0.13
224 0.11
225 0.09
226 0.08
227 0.08
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.07
238 0.09
239 0.13
240 0.18
241 0.2
242 0.28
243 0.36
244 0.45
245 0.55
246 0.64
247 0.7
248 0.76
249 0.85
250 0.88
251 0.91
252 0.93
253 0.92
254 0.93
255 0.93
256 0.91
257 0.88
258 0.87
259 0.85
260 0.83
261 0.8
262 0.7
263 0.63
264 0.55
265 0.48
266 0.4
267 0.32
268 0.24
269 0.16
270 0.15
271 0.14
272 0.14
273 0.12
274 0.11
275 0.1
276 0.09
277 0.12
278 0.12
279 0.11
280 0.1
281 0.1
282 0.12
283 0.13
284 0.14
285 0.13
286 0.2
287 0.22
288 0.24
289 0.24
290 0.23
291 0.23
292 0.22
293 0.2
294 0.14
295 0.12
296 0.1
297 0.12
298 0.14
299 0.17
300 0.2
301 0.22
302 0.27
303 0.36
304 0.47
305 0.54
306 0.63
307 0.7
308 0.77
309 0.86
310 0.9
311 0.91
312 0.9
313 0.9
314 0.89
315 0.89
316 0.85
317 0.81
318 0.74
319 0.64
320 0.54
321 0.47
322 0.37
323 0.27
324 0.23
325 0.15
326 0.13
327 0.15
328 0.16
329 0.14