Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163IXM4

Protein Details
Accession A0A163IXM4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-29IGVVRLKKVNSSKKTRRSWYHAIDTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 12.499, nucl 11, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MRPIGVVRLKKVNSSKKTRRSWYHAIDTKYVHILVKFERRLPIQFNGLFLRIEIDNLRLNLKRQPMSNDRIVVGARRRWTGCCSCTKRLDGWNLTLYQLDEQDSVHTIEKGTSSSSNDVLVSSISSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.74
4 0.83
5 0.85
6 0.84
7 0.83
8 0.83
9 0.81
10 0.81
11 0.77
12 0.71
13 0.66
14 0.58
15 0.52
16 0.44
17 0.36
18 0.26
19 0.21
20 0.19
21 0.2
22 0.27
23 0.27
24 0.28
25 0.31
26 0.32
27 0.34
28 0.36
29 0.34
30 0.32
31 0.3
32 0.3
33 0.28
34 0.27
35 0.24
36 0.19
37 0.18
38 0.11
39 0.12
40 0.1
41 0.1
42 0.11
43 0.11
44 0.14
45 0.13
46 0.15
47 0.18
48 0.22
49 0.22
50 0.21
51 0.27
52 0.3
53 0.33
54 0.36
55 0.33
56 0.28
57 0.28
58 0.26
59 0.24
60 0.23
61 0.22
62 0.21
63 0.22
64 0.23
65 0.24
66 0.29
67 0.31
68 0.31
69 0.38
70 0.43
71 0.46
72 0.5
73 0.51
74 0.49
75 0.49
76 0.53
77 0.46
78 0.43
79 0.4
80 0.36
81 0.34
82 0.31
83 0.26
84 0.19
85 0.17
86 0.14
87 0.11
88 0.1
89 0.11
90 0.12
91 0.13
92 0.13
93 0.13
94 0.12
95 0.12
96 0.13
97 0.13
98 0.14
99 0.15
100 0.17
101 0.2
102 0.2
103 0.2
104 0.2
105 0.19
106 0.17
107 0.15
108 0.12