Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1G8T9

Protein Details
Accession C1G8T9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYSCISSRRRRRRGQQPFHGTGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
KEGG pbn:PADG_03675  -  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MYSCISSRRRRRRGQQPFHGTGWAAQPPFWQQGRQQNQYQYPSAPPPQYTQGNYYAQKPTPFGGQQYPPQEQGVELQPPQNVYRAGEQVYQAPVGPPPTMNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.91
4 0.86
5 0.78
6 0.69
7 0.58
8 0.48
9 0.42
10 0.35
11 0.25
12 0.19
13 0.19
14 0.21
15 0.26
16 0.25
17 0.23
18 0.24
19 0.34
20 0.42
21 0.46
22 0.47
23 0.47
24 0.52
25 0.53
26 0.49
27 0.41
28 0.35
29 0.33
30 0.33
31 0.28
32 0.24
33 0.22
34 0.26
35 0.27
36 0.26
37 0.25
38 0.26
39 0.29
40 0.29
41 0.3
42 0.28
43 0.27
44 0.26
45 0.25
46 0.21
47 0.2
48 0.2
49 0.19
50 0.21
51 0.23
52 0.27
53 0.31
54 0.33
55 0.3
56 0.3
57 0.28
58 0.23
59 0.22
60 0.21
61 0.19
62 0.17
63 0.18
64 0.18
65 0.2
66 0.21
67 0.22
68 0.19
69 0.18
70 0.21
71 0.22
72 0.24
73 0.24
74 0.24
75 0.24
76 0.25
77 0.23
78 0.19
79 0.17
80 0.17
81 0.17
82 0.17