Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168PYQ3

Protein Details
Accession A0A168PYQ3   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LWEHQGDDERKRRRKKLGPNDRNVVLBasic
NLS Segment(s)
PositionSequence
15-22RKRRRKKL
Subcellular Location(s) nucl 20.5, mito_nucl 11.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MDLFILWEHQGDDERKRRRKKLGPNDRNVVLVDQVRPDWQDQFNLKKTNPHSNDSTEWITVQQQRRNRRRLSGSMSGSGTTRRIIVRPAMQSSLTSRTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.62
4 0.69
5 0.74
6 0.8
7 0.83
8 0.85
9 0.86
10 0.88
11 0.87
12 0.85
13 0.75
14 0.67
15 0.56
16 0.46
17 0.37
18 0.28
19 0.2
20 0.15
21 0.15
22 0.14
23 0.14
24 0.14
25 0.15
26 0.14
27 0.18
28 0.2
29 0.26
30 0.31
31 0.34
32 0.33
33 0.35
34 0.38
35 0.44
36 0.43
37 0.41
38 0.38
39 0.38
40 0.39
41 0.37
42 0.35
43 0.25
44 0.22
45 0.2
46 0.21
47 0.23
48 0.28
49 0.29
50 0.34
51 0.44
52 0.53
53 0.61
54 0.61
55 0.63
56 0.64
57 0.66
58 0.67
59 0.66
60 0.6
61 0.56
62 0.53
63 0.45
64 0.39
65 0.33
66 0.27
67 0.18
68 0.17
69 0.14
70 0.15
71 0.17
72 0.23
73 0.28
74 0.33
75 0.36
76 0.36
77 0.35
78 0.36
79 0.37