Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168QE20

Protein Details
Accession A0A168QE20    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
54-88GGKKHGGKKHGDKKHGKKHGDKKHGKKHGKRDIIABasic
112-166GSATRVPTKTKSKPKPKPTHKPTHKSQKPKPKPKTTHKSKKPKPTHKPTHKPGHKBasic
NLS Segment(s)
PositionSequence
54-84GGKKHGGKKHGDKKHGKKHGDKKHGKKHGKR
118-166PTKTKSKPKPKPTHKPTHKSQKPKPKPKTTHKSKKPKPTHKPTHKPGHK
Subcellular Location(s) extr 21, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKLNLLIAACILTFVAAGQCAEQINGDFANVVARGVEHPLDLGDPATSGPPTHGGKKHGGKKHGDKKHGKKHGDKKHGKKHGKRDIIAPFPASSGPVIPPPSTQTGGPPPQGSATRVPTKTKSKPKPKPTHKPTHKSQKPKPKPKTTHKSKKPKPTHKPTHKPGHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.07
7 0.08
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.07
15 0.07
16 0.09
17 0.09
18 0.08
19 0.06
20 0.06
21 0.07
22 0.09
23 0.1
24 0.07
25 0.07
26 0.08
27 0.08
28 0.08
29 0.07
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.11
38 0.14
39 0.2
40 0.23
41 0.25
42 0.33
43 0.42
44 0.5
45 0.5
46 0.54
47 0.55
48 0.62
49 0.69
50 0.69
51 0.7
52 0.72
53 0.76
54 0.81
55 0.83
56 0.78
57 0.78
58 0.8
59 0.82
60 0.82
61 0.82
62 0.82
63 0.83
64 0.87
65 0.87
66 0.84
67 0.84
68 0.84
69 0.81
70 0.72
71 0.68
72 0.64
73 0.58
74 0.52
75 0.42
76 0.32
77 0.25
78 0.24
79 0.18
80 0.11
81 0.08
82 0.08
83 0.09
84 0.11
85 0.11
86 0.11
87 0.13
88 0.16
89 0.17
90 0.16
91 0.17
92 0.22
93 0.25
94 0.26
95 0.24
96 0.21
97 0.23
98 0.25
99 0.24
100 0.22
101 0.25
102 0.3
103 0.32
104 0.35
105 0.39
106 0.46
107 0.54
108 0.6
109 0.65
110 0.68
111 0.77
112 0.84
113 0.89
114 0.91
115 0.93
116 0.92
117 0.93
118 0.93
119 0.91
120 0.9
121 0.9
122 0.88
123 0.88
124 0.87
125 0.88
126 0.88
127 0.91
128 0.91
129 0.91
130 0.92
131 0.93
132 0.94
133 0.94
134 0.94
135 0.94
136 0.95
137 0.93
138 0.94
139 0.94
140 0.94
141 0.94
142 0.94
143 0.94
144 0.94
145 0.96
146 0.94