Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168QE20

Protein Details
Accession A0A168QE20   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
54-88GGKKHGGKKHGDKKHGKKHGDKKHGKKHGKRDIIABasic
112-166GSATRVPTKTKSKPKPKPTHKPTHKSQKPKPKPKTTHKSKKPKPTHKPTHKPGHKBasic
NLS Segment(s)
PositionSequence
54-84GGKKHGGKKHGDKKHGKKHGDKKHGKKHGKR
118-166PTKTKSKPKPKPTHKPTHKSQKPKPKPKTTHKSKKPKPTHKPTHKPGHK
Subcellular Location(s) extr 21, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKLNLLIAACILTFVAAGQCAEQINGDFANVVARGVEHPLDLGDPATSGPPTHGGKKHGGKKHGDKKHGKKHGDKKHGKKHGKRDIIAPFPASSGPVIPPPSTQTGGPPPQGSATRVPTKTKSKPKPKPTHKPTHKSQKPKPKPKTTHKSKKPKPTHKPTHKPGHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.07
7 0.08
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.07
15 0.07
16 0.09
17 0.09
18 0.08
19 0.06
20 0.06
21 0.07
22 0.09
23 0.1
24 0.07
25 0.07
26 0.08
27 0.08
28 0.08
29 0.07
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.11
38 0.14
39 0.2
40 0.23
41 0.25
42 0.33
43 0.42
44 0.5
45 0.5
46 0.54
47 0.55
48 0.62
49 0.69
50 0.69
51 0.7
52 0.72
53 0.76
54 0.81
55 0.83
56 0.78
57 0.78
58 0.8
59 0.82
60 0.82
61 0.82
62 0.82
63 0.83
64 0.87
65 0.87
66 0.84
67 0.84
68 0.84
69 0.81
70 0.72
71 0.68
72 0.64
73 0.58
74 0.52
75 0.42
76 0.32
77 0.25
78 0.24
79 0.18
80 0.11
81 0.08
82 0.08
83 0.09
84 0.11
85 0.11
86 0.11
87 0.13
88 0.16
89 0.17
90 0.16
91 0.17
92 0.22
93 0.25
94 0.26
95 0.24
96 0.21
97 0.23
98 0.25
99 0.24
100 0.22
101 0.25
102 0.3
103 0.32
104 0.35
105 0.39
106 0.46
107 0.54
108 0.6
109 0.65
110 0.68
111 0.77
112 0.84
113 0.89
114 0.91
115 0.93
116 0.92
117 0.93
118 0.93
119 0.91
120 0.9
121 0.9
122 0.88
123 0.88
124 0.87
125 0.88
126 0.88
127 0.91
128 0.91
129 0.91
130 0.92
131 0.93
132 0.94
133 0.94
134 0.94
135 0.94
136 0.95
137 0.93
138 0.94
139 0.94
140 0.94
141 0.94
142 0.94
143 0.94
144 0.94
145 0.96
146 0.94